SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003746 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003746
Domain Number 1 Region: 1875-2119
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.02e-53
Family Ankyrin repeat 0.0000000566
Further Details:      
 
Domain Number 2 Region: 860-990
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000612
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 3 Region: 1173-1315
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 402-535
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 5 Region: 531-574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000693
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 6 Region: 632-760
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000014
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 757-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000168
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 8 Region: 989-1104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000581
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number 9 Region: 794-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000161
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 606-644
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000354
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 11 Region: 209-342
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000377
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 12 Region: 144-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000559
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1144-1187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000132
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 14 Region: 568-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000038
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 15 Region: 107-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family EGF-type module 0.012
Further Details:      
 
Domain Number 16 Region: 835-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000371
Family EGF-type module 0.016
Further Details:      
 
Domain Number 17 Region: 1311-1355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000135
Family EGF-type module 0.015
Further Details:      
 
Domain Number 18 Region: 1532-1564
Classification Level Classification E-value
Superfamily Notch domain 0.000000144
Family Notch domain 0.0036
Further Details:      
 
Domain Number 19 Region: 1492-1525
Classification Level Classification E-value
Superfamily Notch domain 0.000000157
Family Notch domain 0.0043
Further Details:      
 
Domain Number 20 Region: 1451-1483
Classification Level Classification E-value
Superfamily Notch domain 0.00000017
Family Notch domain 0.00058
Further Details:      
 
Domain Number 21 Region: 1392-1431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000188
Family EGF-type module 0.011
Further Details:      
 
Domain Number 22 Region: 335-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000073
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 23 Region: 64-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000982
Family EGF-type module 0.009
Further Details:      
 
Domain Number 24 Region: 1116-1152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.022
Further Details:      
 
Domain Number 25 Region: 1352-1389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000493
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000003746
Domain Number - Region: 377-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family EGF-type module 0.097
Further Details:      
 
Domain Number - Region: 29-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000781
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003746   Gene: ENSGALG00000002375   Transcript: ENSGALT00000003754
Sequence length 2554
Comment pep:known_by_projection chromosome:Galgal4:17:7809850:7842342:1 gene:ENSGALG00000002375 transcript:ENSGALT00000003754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPRGGVHCPGLCAVPDALLLFPGVRCTQLAESCLNGGKCETFLNGTEVCQCSSAHMGERC
QLPNPCLSSPCKNAGTCIPLLRGSTADYTCVCRLGFTDELCLTPLDNACLNNPCRNGGTC
DLVTLSEYKCRCPPGWSGKTCQQADPCASNPCANGGQCVPFEAHYICRCTAGFHGANCKQ
DVNECNISPPVCKNGGSCTNEVGTYQCSCKPAYTGQNCEHLYVPCNPSPCQNGGTCRQTG
DTTYDCTCLPGFTGQNCEENIDDCPGNNCRNGGTCVDGVNTYNCQCPPEWTGQYCTEDVD
ECQLMPNACQNGGTCHNNHGGYNCVCVNGWTGEDCSENIDDCAMAACFQGATCHDRVASF
YCECPHGRTGLLCHLDDACISNPCNEGSNCDTNPVNGKAICTCPSGYMGPACNQDVDECS
LGANPCEHAGKCINTQGSFQCQCLQGYSGPRCEIDVNECLSNPCQNDATCLDQIGEFQCI
CMPGYEGVYCEINTDECASSPCLHNGNCLDKINEFHCECPTGFNGHLCQFDIDECASTPC
KNGAKCVDGPNTYSCECTEGFSGVHCEIDIDECNPDPCHYGTCKDSIAAFTCLCQPGYTG
HRCDININECQSQPCRNGGTCQDRDNAYNCLCLKGTTGPNCEINLDDCASNPCDYGKCID
KINGYECTCEPGYTGRMCNINIDECASNPCHNGGTCKDGINGFTCLCPEGFHDPKCLSEV
NECNSNPCIHGRCHDGLNGYRCDCDPGWSGTNCDINNNECESNPCMNGGTCKDMTSGYIC
TCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYTCNCLLPYTGATCEDVLAPCAGGP
CKNGGECRESEDYKRFSCSCPPGWQGQTCEIDINECVKSPCRNGATCQNTNGSYRCLCRV
GFAGRNCDTDIDDCQPNPCHNGGSCSDGIGTFFCECLAGFRGLKCEEDINECASNPCKNG
ANCTDCVNSYTCTCPSGFSGIHCENNTPDCTESSCFNGGTCVDGINTFTCLCPSGFTGSY
CEHNINECDSKPCLNGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQT
NNLYRCECNSGWTGLYCDVPSVSCEVAAKQQGIDVAHLCRNSGLCVDSGNTHFCRCQAGY
TGSYCEEQVDECSPNPCQNGATCTDYLGGYSCECVAGYHGVNCSEEINECLSHPCQNGGT
CIDLINTYKCSCPRGTQGVHCEINVDDCSPFFDPVTLGPKCFNNGKCTDRVGGYSCICPP
GFVGERCEGDVNECLSNPCDARGTQNCVQRVNDYKCECRPGYAGRRCDTVVDGCKGKPCR
NGGTCAVASNTGRGFICKCPPGFVGATCENDSHTCGTLHCLNGGTCISMHKSSKCVCAAA
FTGPECQYPASSPCISNPCYNGGTCEFLSDASPYYHCNCPANFNGLNCHILDFDFQGGFG
QDIIPPKIEEKCEIAVCASYAGNKICDGKCNNHACGWDGGDCSLNFNDPWKNCSQSLQCW
KYFNDGKCDSQCNNAGCLYDGFDCQKYEGQCNPLYDQYCKDHFSDGHCDQGCNNFECEWD
GLDCANNMPEKLADGTLVVVVLITPENLKNNSFNFLRELSRVLHTNVVFKKNAKGEYMIF
PYYGNEEELKKHYIKRSTEDWADMSSAVINKVKSSLYSRAGRRQKRELDQMDIRGSIVYL
EIDNRQCIQSSSQCFQSATDVAAFLGALASLGNLNIPYKIEAVKSETAEPARNSQLYPMY
VVVAALVLLAFIGVGVLVSRKRRREHGQLWFPEGFKVTESSKKKRREPLGEDSVGLKPLK
NASDGTLMDDNQNEWGDEETLDTKKFRFEEQAMLPDTDDQTDHRQWTQQHLDAADLRISS
MAPTPPQGEIDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEDDAPAVISDFIYQG
ASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVF
QILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINCHADVNAVDDLGKSALHWAAA
VNNVEAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLP
RDIAQERMHHDIVRLLDEYNLVRSPPLHSGPLGAPTLSPPLCSPSSYIGNLKPAVQGKKA
RKPSTKGLSCNGKDSKDLKARRKKSQDGKGCLLDNSSVLSPVDSLESPHGYLSDVASPPL
MTSPFQQSPSMPLNHLPGMPDAHMSINHLNMAGKQEMALGGSGRMAFEAVPPRLSHLPVS
SPSTAMSNAPMNFSVGGAAGLSGQCDWLSRLQSGMVQNQYGAMRGGMQPGTHQQAQNLQH
GMMSSLHNGLPSTSLSQMMSYQAMPSTRLASQPHLLQNQQMQQMQQPGMQPQPGMQPQPG
MQQPQQQPQQQPQPQQHHNPGSNASGHMGQNFLGTELSQPDMQPVSSSAMAVHTILPQDS
QLLPTSLPSSLAQPMTTTQFLTPPSQHSYSSPLDNTPSHQLQVPDHPFLTPSPESPDQWS
SSSPHSNVSDWSEGISSPPTSMQSQMGHIPEAFK
Download sequence
Identical sequences ENSGALP00000003746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]