SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003823 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003823
Domain Number 1 Region: 1175-1238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.23e-17
Family Complement control module/SCR domain 0.0056
Further Details:      
 
Domain Number 2 Region: 138-208
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000115
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 84-155
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000419
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 1049-1111
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000125
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 5 Region: 811-872
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000197
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 631-688
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000367
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1117-1176
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000367
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 8 Region: 937-1006
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000131
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 9 Region: 997-1061
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 10 Region: 206-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000223
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 11 Region: 565-626
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000695
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 12 Region: 862-933
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000315
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 13 Region: 516-575
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000148
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 14 Region: 450-510
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000017
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 15 Region: 394-453
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000229
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 16 Region: 263-328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000511
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 17 Region: 691-747
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000998
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 18 Region: 30-80
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000537
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 19 Region: 1242-1302
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000151
Family Complement control module/SCR domain 0.0069
Further Details:      
 
Domain Number 20 Region: 327-388
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000603
Family Complement control module/SCR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003823   Gene: ENSGALG00000002431   Transcript: ENSGALT00000003831
Sequence length 1306
Comment pep:known chromosome:Galgal4:8:2641142:2673492:-1 gene:ENSGALG00000002431 transcript:ENSGALT00000003831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLGYAALLLCWMYCTAERACEQSPPRRVKEIPTETWDNPPYPHGTLVTYKCRPGYIKI
GRIVVKCADGVWKQQGNTECRSKPCGHPGDIEFGSFQLTAGNEFVFGARVEYRCNDGYRM
LSQKNYRECLAEGWSNDIPHCEVAKCLPVKAPENGRIVLSGAFELNREYSFGEVMEFECN
EHYRLVGSKAIHCSSNGKWDSDVPQCQDIICNVPSIPNGVVRSSQKTYRESEQLHYVCNK
GYTYGERADAQCTESGWSPTPYCTEVVCFPPTFRNGNFRPQKDRYTEGATITIDCDLGYR
YSTLTAKNVAKCTSSGWVPAPGCVEKPCDYPAVENIRLSGNWQQNYFPMRIGQTIYYRCR
EGYLTPSEEYWVHIVCSQGGWKPEPQCLKRCDVGPLENGYIQNNWKRYFKEGERTKYFCN
KNYRTENEDGEITCSKNGWSPTPRCIRKETCQWVDLTNGYFMERRATFDIGETVSYSCYN
DFVTPEKQKMGMIQCQKNGWSPPPKCIQTCKTSHIHTLVDCGPRENIYLPGDILEYSCPE
KYKTVDNMPYSTTRCDVNGEWKPTPHCVAIECKLPVLSHGQAHPSKNTYYNGDVVKFICV
KNYIRVGPASSQCYYFGWFPSPPTCKVDPRDCGPPPEITNGNVIGGFLERYQHGNRMEYE
CDTPFTLVGSKEIECLDGQWSSLPSCIENKMPCGSPSSVLNVVLLQQDRAQFSHGDEVTY
RCSQGSENATRMRTKCLNGEWKPSPLCNDPFHQCVTPEDIVIERTGSHRKAKETGLYLTY
KCKPADRQFKQATCVSGKWTPEIQCTGESTCPLPPQLPNANKIPIGRNYKNGSKIAFSCL
EGFHLIGANEIMCINGKWQSPPYCVEKPCSPPQPVEHADDVRLVNQSLKMEKEGKTVYLA
GAVVKFTCHSGFELDGPSEISCSMGNWSSYPTCSEASCGSIPNVPNSAIEGRNKEAYEPG
ETIRYQCDEGFEAVGVPEIICRKGNWSTPPFCEDVSCEAPPEIHNAYITSPQQQRYLPGA
RVQYECDSHFQITAVNYVTCSNGQWLQTPTCKDTRCGPPPEISGGKVQGFKKSRYLPGET
AKYECWKGFRMTGASTVSCQNGTWTELPTCKGKSEKCGPPPDIENGDILSFPMPEYSQGE
TLKYKCPNLYILEGSQQITCINGQWTNPPVCLVACTAAEEDMNNNNIELKWREESKLYSR
PGDFIEFDCKIGNVEDPASSPFRVQCINGTFKYPRCNPGRDCRVLESEMDKNNIQLQWRM
PHTYRSKERISFKCKWLYEPVSRPEKFKPRCLDGVIEYPQCAYRWK
Download sequence
Identical sequences E1C7P4
XP_426613.3.86415 ENSGALP00000003823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]