SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003918 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000003918
Domain Number - Region: 88-143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0401
Family Complement control module/SCR domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003918   Gene: ENSGALG00000002493   Transcript: ENSGALT00000003927
Sequence length 215
Comment pep:known chromosome:Galgal4:6:3934337:3938352:1 gene:ENSGALG00000002493 transcript:ENSGALT00000003927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKNAVRLLPALENAVFYLSETGAFASESDCDSTTVDNVIQSLQKYSTCFPEVAKKDGRDL
LNRLIWILKDTLNLLQPVQDKFCKHVPQCPQPIAPKNGGIVCITIGSTEYCKPMCNKGYD
FSFLRRSRLYETCGSTTEFTWTTQLTGGQTLAVCEPSERAVSGAESAYFPDNSSCLHTLA
YSESEQLETFLGELAKQGIDTTNHDKEADCLICGY
Download sequence
Identical sequences ENSGALP00000003918 9031.ENSGALP00000003918 ENSGALP00000003918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]