SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003921 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003921
Domain Number 1 Region: 85-198
Classification Level Classification E-value
Superfamily C-type lectin-like 1.35e-26
Family C-type lectin domain 0.0000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003921   Gene: ENSGALG00000002496   Transcript: ENSGALT00000003930
Sequence length 198
Comment pep:known chromosome:Galgal4:6:3953643:3956579:-1 gene:ENSGALG00000002496 transcript:ENSGALT00000003930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLQLFHQILGLMLLLLPCYAHGKPTQIFPVPGFKAERGISQAYLPGFPSVAGSEMDDA
VLQLKDRISKLEGVLYLQGKITKSGGKIFATSGKTADFHATVKMCQEAGGCIASPRNADE
NAAILHFVKQFNRYAYLGIKESLIPGTFQFLNGGELSYTNWYSHEPSGKGEEECVEMYTD
GTWNDRRCNQNRLVVCQF
Download sequence
Identical sequences Q2LK96
ENSGALP00000003921 ENSGALP00000003921 9031.ENSGALP00000003921 NP_001034255.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]