SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000003937 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000003937
Domain Number 1 Region: 109-222
Classification Level Classification E-value
Superfamily C-type lectin-like 7.39e-28
Family C-type lectin domain 0.0000498
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000003937   Gene: ENSGALG00000002503   Transcript: ENSGALT00000003946
Sequence length 222
Comment pep:known chromosome:Galgal4:6:3961966:3967496:-1 gene:ENSGALG00000002503 transcript:ENSGALT00000003946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSYSFCMIAAAVALLTPCHAQNCAGAPELPSIPGVSGLLGLGALKRYFGSLLWPYGEEK
LPECQWLQRQQDLSTSSDDELGNVLLNLRQRILQLEGVLALDGKITKVGEKIFASNGKEV
NFSSALESCEETGGTLATPMNEEENKAIMGIVKQYNRYAYLGIKESDTAGQFKYVNNQPL
NYTSWQQYEPNGKGTEKCVEMYTDGNWKDRKCNLYRLTVCEY
Download sequence
Identical sequences Q90XB2
ENSGALP00000003937 ENSGALP00000042366 NP_989937.1.86415 XP_015143440.1.86415 9031.ENSGALP00000003937 ENSGALP00000003937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]