SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004002 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004002
Domain Number 1 Region: 339-639
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.37e-92
Family beta-glycanases 0.000000000289
Further Details:      
 
Domain Number 2 Region: 35-234
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.98e-53
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0000000641
Further Details:      
 
Domain Number 3 Region: 236-338
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 2.48e-23
Family beta-Galactosidase/glucuronidase domain 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004002   Gene: ENSGALG00000002542   Transcript: ENSGALT00000004011
Sequence length 657
Comment pep:known chromosome:Galgal4:19:4921170:4931757:-1 gene:ENSGALG00000002542 transcript:ENSGALT00000004011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAPCGVAGQCRLQLLVLVVAAAAGRAAAAVRGGMLYPRESPSRELKELGGIWSFRAD
FSPGRDAGFEQRWYRQPLRQTGPVIDMPVPASFNDITQDPHLENYIGWVWYEKEVLIPQR
WLQDDLSTRVVLRFGSAHYYSIVWVNGVQVVEHEGGHLPFEADISRIVQRSPGVLCRITV
ALNNTLTPHTLPPGSIQYMNDRTRYPKNYFVQNTRFDFFNYAGIHRPVVLYTTPSVYIDD
ITVTTTSSESVAMVRYQISVVGSELYSLSLSLRDQEGKVVATGDGPSGELKVPNPNLWWP
YLMHENPGYRYFLEVKMQAQASGVPQEDIYTLPVGIRTVHVTSTQFLINGKPFYFHGVNK
HEDADIRGKGLDWALIVKDFNLLRWLGANSFRTSHYPYAEEIMDLCDTYGIVVIDECPGV
GIKMPESFGNKSLQHHLVVMEELIRRDKNRPSVVMWSVANEPASELPPAAYYFKTLIAHT
KALDPSRPVTFVSDTNYAVDHGAPYVDVICVNSYFSWYHDPGHLEVIPLQLTAQFENWYK
TYQKPIIQSEYGADSIPGLHSDPPAMFSEEYQKAMLKEYHSVFDKKRKEYVIGELIWNFA
DFMTDQGTTRVLGNKKGIFTRQRQPKSAAFVLRERYWKIANESSCVPPIIKSHILFL
Download sequence
Identical sequences F1NI86
ENSGALP00000004002 ENSGALP00000004002 9031.ENSGALP00000004002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]