SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004083 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004083
Domain Number 1 Region: 1474-1582
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-34
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 2 Region: 776-890
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-33
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 3 Region: 1997-2106
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-32
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 4 Region: 1820-1939
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-32
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 5 Region: 602-721
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-32
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 6 Region: 55-163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-29
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 7 Region: 232-334
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-29
Family Spermadhesin, CUB domain 0.00081
Further Details:      
 
Domain Number 8 Region: 2169-2276
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-29
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 9 Region: 435-546
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-29
Family Spermadhesin, CUB domain 0.00098
Further Details:      
 
Domain Number 10 Region: 1300-1408
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-27
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 11 Region: 1133-1236
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-27
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 12 Region: 948-1069
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-26
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 13 Region: 2337-2456
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-25
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 14 Region: 1642-1757
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-25
Family Spermadhesin, CUB domain 0.005
Further Details:      
 
Domain Number 15 Region: 2943-3010
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.7e-19
Family Complement control module/SCR domain 0.00057
Further Details:      
 
Domain Number 16 Region: 2703-2771
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.48e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 17 Region: 3059-3130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.24e-18
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 18 Region: 3119-3188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 19 Region: 2760-2828
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.51e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 20 Region: 2644-2713
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-16
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 21 Region: 2455-2528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.48e-16
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 22 Region: 3000-3070
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.73e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 23 Region: 372-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000202
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 24 Region: 3239-3307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000473
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 25 Region: 2819-2886
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000702
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 26 Region: 2875-2936
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000089
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 27 Region: 2111-2179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 28 Region: 896-956
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 29 Region: 1938-1999
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000306
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 168-229
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000661
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 31 Region: 2518-2585
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000113
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 1587-1654
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000115
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 33 Region: 1414-1479
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 34 Region: 1239-1302
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 35 Region: 550-615
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 36 Region: 721-789
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 37 Region: 3171-3233
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000001
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 38 Region: 3298-3356
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000264
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 39 Region: 1764-1828
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000306
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 40 Region: 2281-2347
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000324
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 41 Region: 1069-1131
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000607
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 42 Region: 2589-2651
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000931
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004083   Gene: ENSGALG00000002602   Transcript: ENSGALT00000004092
Sequence length 3597
Comment pep:known_by_projection chromosome:Galgal4:23:4570631:4804042:1 gene:ENSGALG00000002602 transcript:ENSGALT00000004092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPSLGWDRPGCSCSLGRNWGKLGILALMTVEWSSWSRLLLLSVGLLAASANAQNCSHIL
HGPNGTIQSPGFPYGYPNYANCTWTITAEEQNRIQLVFQSFALEEDFDVLSIYDGLPQQG
NLRTRLTGFQLPAPIVSTGVVLSLWLVSDYAVSAQGFQANYEVLPSHTCGNPGRLQNGVQ
QGTTFSIGDKVRYSCNPGFFLEGHALLTCQASMENGASWDFPLPFCRADDACGGTLRGQS
GIISSPHFPLEYGNNADCTWTILAEPGDTIALVFMDFQLEDGYDVLEVAGTEGSSLWFTG
MNLPAPVISSKNWLRLHFTSDGNHRQKGFSAQYQVKKQMELKSRGVKLMPSKNSNQKTSV
LTQVGVSQGHNMCPDPGIPERGKRIGNDFRLGSSIQFTCNEGYDLQGSKSITCKRVSDII
VAWSDHRPVCRARMCDMYLRGPSGVITSPNYPVQYDNNAYCVWVITALNPAKVIKLTFEE
FELERGYDTLTVGDGGQVGDQKSVLYVLTGTTVPDLIVSTQHQMWLLFQTDSVSNLLGFK
ATYEEIDQGSCGDPGVPAYGRREGSTFRHGDSLKFECQPAFELKGQKTITCQKSSQWSAQ
KPVCVFSCFFNFTTPSGIVLSPNYPEEYGSSLHCVWLIIAKPESRIHLAFNDFDVEPQFD
FLAVKDGGTAESPVLGTFSGSQIPSSLTSSGHVARLEFQTDHSMEKRGFNITFTTFRHNE
CPDPGVPVNGKRFGDSLQLGSSVSFLCDEGFIRTHGSETITCILKEGNVVWNNAVLRCEA
PCGGHLTSPSGTILSPGWPGFYKDSLSCAWVIEAQPGYPIKITFDRFKTEVNYDTLEVRD
GRSYSSPLIGVYDGTQVPQFLISTSNYLYLLFTTDKSHSDVGFQIRYETVKLQSDHCLDP
GIPVNGQRHGNDFYVGALVTFSCDSGYTLSDNEALECEPNFQWSRPLPSCEALCGGYIRG
SSGTILSPGFPDFYPNNLNCTWTIETSHGKGVFFTFHTFHLENGHDYLLITENSSFAQPL
KQLTGSRLPAPLSAGLFGNFSAQIRFISDFSMSYEGFNITFSEYDLEPCDEPEVPAYSIR
KGLQFGVGDVLTFSCFPGYRLEGTARITCLGGRRRVWSSPLPRCVAECGSSVTGTQGVLL
SPNYPINYNNNHECIYSIQTQPGKGIQLKARTFELEAGDVLKVYDGSNSSARLLGSFSRS
EMLSTSINSTSSSMWLEFITNSENTSKGFELQFSSFELIKCEDPGIPQFGYKVHDEGHFA
GSSVSFNCDPGYTLRGSRVLVCLTGERRAWDQPLPTCVAECGGSIKGETSGRILSPGYPT
PYDHNLNCIWSIEAEAGCTIGLHFMVFHTEEFHDVLRIWDGPVENGILLKEMSGSVLPSD
VHSTFNSVILQFNTDFFTSKQGFAIQFSVSTATSCNDPGIPQNGSRSGDSKEAGDSIVFQ
CNPGYALQGEAKITCVQIENRFFWQPDPPSCTAPCGGILTGPAGVILSPQYPEPYPPGKE
CDWKLTVSPDYVIALVFNIFSLEPGYDFLHIYDGPDSLSPLIGSFYGSQLPERIESSSNS
LFLAFRSDASVSNSGFVIEYTENPRESCFDPGSIKNGTRVGTDLKLGSTITYYCDGGYDI
EGVSTLTCIMGEDGKPAWNKPRPTCTAPCGGQYTGSDGVVLSPNYPQNYTSGQVCLYFIV
VPKDYVVFGQFAFFQTALNDIIEVHDGPNEHSRLLSSLSGSHTGESLPLATTNQILIKFS
SKGQSTAKGFHFVYQAVPRTSATQCSSVPEPRYGRRLGSDFAVGAVVRFECSAGYVLQGS
RSIECLTMPGALAQWNVSVPTCVVPCGGNLTERKGTILSPGFPEPYLNSLNCVWKISVPE
GAGIQIQVISFVTEQNWDSLEVFDGGDNTATMLGSFSGTTVPALLNSTSNQLYLHFYSDI
SVSAAGFHLEYKTVGLSSCPEPPVPGNGLKVGERYLVNDVVSFQCEPGYALQGHSHISCM
PGTVRRWNYPPPLCIAQCGGTAEEMEGVLLSPGFPGNYPSNLDCTWRILLPVGFGAHIQF
LNFSTEPNHDFVEVRNGPYDTSNVIGRFSGTEIPGSLLSTSHETTVYFHSDHSQNKPGFK
LEYQAYELQECPDPEPFANGVVRGAGYNVGQSISFECLPGYQLIGHPVLTCQHGTNRNWD
HPLPRCEVPCGGNVTTQNGTVYSPGFPNQYPNSQDCTWLLTVPVGYGIHLNFTLLQTEPY
NDFITIWDGPQQTAPQLGVFTGNSAKKSAQSSSNQVLVKFHSDAANGGIFAIYFYAYQLF
RCQPPTMVPNAEIITENEEFNIGDIVRYRCLPGFTLIGNEILTCKLGTHLQFEGPPPTCE
VPCPMNAVMTDSTGVILSQSFLGSYPHFQTCSWVVKVEPGYNISLTIEYFLSEKQYDEFE
IFDGPSGHSPLLLSLSGNYSAPLTVTSSGNKVYLRWSSDHAYNRKGFKIRYSAPYCSLPQ
PPAHGLILSQTGLQPGSTVRFGCDSGYRLVGHSTATCSQHPQGYFHWNEAIPLCQALSCG
VPRAPKNGVVFGKEYTVGTKAVYHCDQGFQLAPGEPPSTECLQEGQWSNGNQPPPCVAVT
CPDISSIAVEHGRWRLTYEIQYHYNAQLMLICDPGYYYTGQRVIRCQANGKWSIGEPMPT
CKIISCGDLPTPPNGNKIGTLTSYGATAIFSCNTGYTLVGSRVRECMANGLWSGADVRCL
AGHCGVPSPIVNGQINGENYNYRGSVVYQCQPGFRLIGMSVRICQQDHRWSGKTPVCVPI
TCGHPGNPANGLTQGTQFNLNDVAKFVCNTGYRLEGAAQSQCLANGQWSSTLPACRVVNC
TDPGHLENSIRQVQPSGPHRFSFGTTVSYQCSHGYYLLGTHVLTCQGDGTWDRALPQCLL
VSCGHPGSPPHAQISGDKYTVGSVVRYSCLGKRALMGNSTRMCQLDGRWSGSLPHCSGGS
QGVCGDPGIPSHGIGLGDEFGVDSVVRFSCEPGYTLRGSSERTCQANGSWSGVQPECEVI
SCGNPGTPSNARVLFNDGLVFSSSIIYQCREGYYSTGVLSRHCTVNGTWTGSSPECTVIN
CGDPGVPANGIRLGSDFTYNKTVVFQCMPGYMMESDRASSLMCTKDRTWNGTKPACKAII
CKPPQAIPNGKVVGSDFSWGSSVSYACLEGYQLSLPAVLTCEGNGTWSGEIPQCFPVFCG
DPGIPAQGRREDRGFTYRSSVSFSCLAPLVLVGSARRFCQSDGTWSGTQPSCIDPTLTTC
ADPGVPLYGMQNNSQGYQVGSMIFFKCQKGYLLQGSTTRTCLPNLTWSGVQPDCVPHHCK
QPETPSHANVGALDLPSLGYTLIYSCQSGYYLTGGSEHRTCKADGSWTGKPPICLADIRP
SGRPVGTARDPPLSKLSVPADVFARNSLWKGSYEYMGKKQPAMLSVTSFDPVTSKVNATL
IDHSGVELQVSGIYKKEDVHLLLQVYQIMGPVEIFVNKFKNDKWALDGHVSSESSSGTFV
YQGFVRGKGFGQFGLQRLDVSMMENDPESIGHHFASNSSSVAAAILVPFIALIIAGFVLY
LYKHRRRPKVPFNGYAGHENTNVRATFENPMYDRNLQPTDIMANETEFTVSTVCTAV
Download sequence
Identical sequences A0A1D5NTI7
ENSGALP00000004083 XP_015153311.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]