SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004096 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004096
Domain Number 1 Region: 6-97
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-24
Family C-type lectin domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004096   Gene: ENSGALG00000002607   Transcript: ENSGALT00000004105
Sequence length 130
Comment pep:known scaffold:Galgal4:AADN03012949.1:105:1239:-1 gene:ENSGALG00000002607 transcript:ENSGALT00000004105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMLVVLVISTGFAHVCPNAWVGFQGKCCYFLKGENDWNSSREHCNAHGASLATIGSAEEM
DFMMRFQGPANCWIGLHREEEDALWTWSNVTAFTNWRGSPSFSQCIGAAFPFSSLLGTGL
SCEVEADVRT
Download sequence
Identical sequences ENSGALP00000004096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]