SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004098 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004098
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily C-type lectin-like 1.54e-36
Family C-type lectin domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004098   Gene: ENSGALG00000014600   Transcript: ENSGALT00000004107
Sequence length 142
Comment pep:novel scaffold:Galgal4:AADN03010643.1:7822:9309:-1 gene:ENSGALG00000014600 transcript:ENSGALT00000004107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRQVPVPPFPDFAHVCPNAWVGFQGKCYYLSKEEYDWNSSREHCNAHGASLATIGSAEEM
DFMMRFQGPAYCWIGLHREEEDAQWMWSDGTAFTNWFELRGGGRCAYLNGDRISSSLCHL
HKHWVCSRADHYVLWKQKVHPQ
Download sequence
Identical sequences ENSGALP00000004098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]