SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004122 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004122
Domain Number 1 Region: 286-406
Classification Level Classification E-value
Superfamily TIMP-like 2.98e-37
Family Netrin-like domain (NTR/C345C module) 0.00031
Further Details:      
 
Domain Number 2 Region: 24-134
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-35
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 145-258
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.3e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004122   Gene: ENSGALG00000002623   Transcript: ENSGALT00000004131
Sequence length 408
Comment pep:known_by_projection chromosome:Galgal4:9:10041008:10060212:-1 gene:ENSGALG00000002623 transcript:ENSGALT00000004131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLSEVTENCKHSSFVLRPTFTCGGVVSGESGFIGSEGFPGVYPPNSKCTWKITVPEGK
VVVLSFRYLDLESDNLCRYDFVDIYSGHANGQRIGRFCGTVKPGALVSSSNKMLVQMTSD
ANTAGNGFIAKFSAAEPHERGDQYCGGRLEKPSGSFQTPNWPERDYPAGVTCSWHIVAPK
NQLIELKFEKFDVERDNYCRYDYVAVFNGGEINDAKRIGKYCGDSPPAPIVSEKNELFIQ
FLSDLSLTADGFIGHYKFRPKKLPTTTVPPTTTTVPATSIPKPTVALCQQKCKRSGTPES
NYCSSNFVITGTVISTTTRAGSLHATISIINVYKEGNLAIQQAGKNMSAKIIVVCKQCPL
LRRGLNYIIMGQVEEDGRGKIFPNSFVMSFKTKNQKILNSLKNKTCYN
Download sequence
Identical sequences ENSGALP00000004122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]