SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004154 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004154
Domain Number 1 Region: 28-146
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-30
Family C-type lectin domain 0.00000548
Further Details:      
 
Domain Number 2 Region: 557-621
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.27e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 493-566
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.08e-16
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 4 Region: 247-312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-16
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 5 Region: 309-375
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 619-686
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-16
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 369-442
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000486
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 186-256
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000012
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 9 Region: 675-739
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 10 Region: 433-499
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000032
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number 11 Region: 148-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000144
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004154   Gene: ENSGALG00000002643   Transcript: ENSGALT00000004163
Sequence length 807
Comment pep:known_by_projection chromosome:Galgal4:8:3692054:3700865:1 gene:ENSGALG00000002643 transcript:ENSGALT00000004163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALSSCGVCCLGIAAFTCGVVMQVGAWTYNYSEKDYEWDEARAYCKTFFTDLVAIQNKE
EIEYLNRTLPYHNKYYWIGIRKQKGTWTWVGTNKTLTKEATNWAAREPNNRGSNQDCVEI
YIKRPSEAGKWNDEPCTKKKKALCYKASCQPLLCGLHGDCVEVIQSYKCECHPGFEGDNC
ENAVQCPILEPRGASMNCSHPFGDFRYNSTCTFRCPEGFERRGADELQCLDDRQWSAETP
TCIAVTCPVLSAPEHGELNCSHLHGNFTFNSTCDFSCQPGFELTGPQSRECTAVGNWTGE
IPRCKAISCPVLSAPEHGELNCSHLHGSFTFNSTCDFSCQPGFELVGSQSRECTATGNWT
GDTSRCKAVTCPVLSAPEHGELNCSHLHGNFTFNSTCDFSCQPGFELAGPQSRECTAMGN
WTGDTTQCKAISCSVLRAPEHGELNCSHLHGNFTFGSMCNLSCQPGFELLGPQSRKCMPT
RAWTGDTSRCKAVTCPVLSAPKHGELNCSHLHGNFTFNSTCDFSCQPGFELTGPQSRECT
AVGTWSKDTPRCKAVTCPVLSAPEHGELNCSHLHENFTFGSTCDFSCQPGFELLGSQSRE
CTATRTWTRESPQCKAISCSLLSAPEHGELSCFHLYENFTFGSVCDFSCQPGFELIGPQS
RECTATGTWTGNTSQCQAVSCPVLDVPSHSHLSCSNLHGNFTFNSTCTFSCKEGFIRVGA
EMLRCAATGNWTRHPPVCEEDSAFLKQVLVYTSTSALAAAGLVLSGTLIVLLVKQLSNRE
EKKKLLSPTSDLGAPGIFTNAAYDSTL
Download sequence
Identical sequences ENSGALP00000004154 XP_004943196.2.86415 XP_004943197.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]