SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004206 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004206
Domain Number 1 Region: 809-917
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-23
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 2 Region: 29-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.35e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 294-414
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 256-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000447
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 160-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000469
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 625-736
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000534
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 7 Region: 201-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000354
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000004206
Domain Number - Region: 749-804
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0432
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004206   Gene: ENSGALG00000002675   Transcript: ENSGALT00000004215
Sequence length 994
Comment pep:known_by_projection chromosome:Galgal4:26:4079185:4107401:-1 gene:ENSGALG00000002675 transcript:ENSGALT00000004215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALQIAGLCMLALLLHSGITLANKASQDVDECVEGTDSCHIDAICQNTPKSYKCICKSG
YTGDGKHCKDVDECEREDNAGCVHECVNIPGNYRCTCYDGFRLAHDGHNCLDLDECSEGN
GGCQQTCVNMMGSYECFCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGI
ACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTDQGPKCGCHVKFLLHSDGVTCIGER
HFQQHVILETFSNETCAVNNGGCDSKCHDAATGVHCSCPMGFMLQPDRKTCKDIDECRLN
NGGCDHICRNTVGSFECSCKKGYKLLINERNCQDIDECSFDRTCDHLCINTPGSFQCLCN
KGYTLYGLTHCGDVDECSINRGGCKFGCINTPGSYQCTCPAGCKLHWNKKDCIGSVPPRA
TLTCNKTGKKDSCALTCASKARFQPESDSSYTVSCGTPVLRQGSQHRATNSSQQCLETVA
APIKQKASFKIKDAKCHLHPRAKGKQDEGGKAVAQGGAAPCSDCQVAFVNLKCDSSKKGK
GRRARNSSGKEVTRITLEFEAEIKPEETTASCNLHCLRQKVEKKLKSAIKALKKSINQER
FLLRFAGMEYEVARKLSVAPERQESCGPGQQRLGTKCVSCSQGTYYHGQTEQCVPCPSGT
YQEKEGQLSCDLCPRSDAFGPVGATNITGCTGQCPPGQHSTDGFKPCQPCPRGSYQPEVG
RALCFPCGGGLTTRHEGALSFQDCDTKVQCSPGHYYNTSVHRCIRCAVGTYQPDFRQNYC
IACPGNTTTDFDGSTSVSQCKNRQCGGELGEYTGYIESPNYPGNYPANVECTWNINPPPK
RKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFK
TSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFDVLAHP
QNYFKYTEKHKEMLPRSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences XP_015154490.1.86415 ENSGALP00000004206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]