SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004283 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004283
Domain Number 1 Region: 440-702
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.12e-55
Family Eukaryotic proteases 0.0000749
Further Details:      
 
Domain Number 2 Region: 364-456
Classification Level Classification E-value
Superfamily Kringle-like 7.01e-34
Family Kringle modules 0.0000846
Further Details:      
 
Domain Number 3 Region: 189-272
Classification Level Classification E-value
Superfamily Kringle-like 6.77e-33
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 4 Region: 276-359
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-32
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 5 Region: 93-187
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-31
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 6 Region: 19-105
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.47e-19
Family Hairpin loop containing domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004283   Gene: ENSGALG00000002722   Transcript: ENSGALT00000004292
Sequence length 704
Comment pep:known chromosome:Galgal4:12:2479299:2483435:1 gene:ENSGALG00000002722 transcript:ENSGALT00000004292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARLGLLLSLAVALSAGHRSPLNDFQRLRGTELRAAPNEPPPSAPAHGAAQQCAQRCAN
RPDCRAFHHERQSQLCQLLPWSQRSPGARLQKNIHYDLYQKKDFLRECIVANGTSYRGTR
DTTERGLRCQHWQATTPHDHRFLPSLRNGLEENYCRNPDRDKRGPWCYTVDPNVRHQSCG
IKKCEDAVCMTCNGEDYRGFVDHTESGTECQRWDLQHPHKHPYHPDKYPEKGLDDNYCRN
PDSSERPWCYTTDPALEREFCRIRVCKKRPRPINVTTGCYRGKGEGYRGRVNVTVSGIPC
QRWDAQTPHRHHFVPSKYPCKDLQENYCRNPDGSEAPWCFTTRPGMRVAFCFHIRRCDDE
LDAEECYHGHGERYHGHVSKTRKGITCQRWDATTPHVPQISPTTHPEAHLEKNYCRNPDN
DSHGPWCYTMDPRTPFDYCAIKPCSGSAVPSVLENADAVTFEECGRRDERLQQKQRVVGG
MPGNSPWTVSIRNRAGLHFCGGSLVKEQWVISTQQCFSSCDADLSGYEVHLGTLFKDPSP
TDPDLQAIPIVRIICGPSESHLVLLKLAWPAVLNKRVALICLPPERYIVPAGTTCEIAGF
GETRGTADGHVLNVAKLPVMAHAECQAALRGRLKESELCTAPLRAGVGACEGDYGGPLAC
LTADCWVLEGVITPSRVCARTDQPALFIRVSLYVDWIHKVMRMV
Download sequence
Identical sequences ENSGALP00000004283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]