SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004559 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004559
Domain Number 1 Region: 159-538
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 1.25e-92
Family Phosphonoacetate hydrolase 0.045
Further Details:      
 
Domain Number 2 Region: 621-865
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.41e-28
Family DNA/RNA non-specific endonuclease 0.01
Further Details:      
 
Domain Number 3 Region: 65-113
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000445
Family Somatomedin B domain 0.0021
Further Details:      
 
Domain Number 4 Region: 110-155
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000458
Family Somatomedin B domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004559   Gene: ENSGALG00000002869   Transcript: ENSGALT00000004568
Sequence length 886
Comment pep:known_by_projection chromosome:Galgal4:3:56723839:56757736:-1 gene:ENSGALG00000002869 transcript:ENSGALT00000004568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPQSEIGMHQRGHLDQVILQPMDYVKKKTLQKYKIICGVLLGALVIVSLGLGLGLGLNR
GAQEQVSCRHKCNEPYRKEVAGCQCDSGCKERQNCCWDYEDACVEPTRSWSCTNFRCGET
RLPGSYCSCSDDCLQENDCCVNYNTVCKGEIPWVEEPCVSLETPQCPAGFDLPPLILFSM
DGFRAEYLQTWSSLLPNIEKLKTCGTHSKYMRAAYPTKTFPNHYTIVTGLYPESHGIIDN
NMYDVNLNKHFSLSSTEKFQPSWWKGQPMWLTAMYQGLKAGTFFWPGSDVPINGTYPNLF
YLFNSSVTYQERISGVLKWLDKAKSERPDFYTLYIEEPDSSGHSFGPVSGGVIKALQLAD
ETLGMLMEGLKQRNLHNCVNLIVLADHGMDMTYCSQLEYMTNYFNQINFYIYAGPAARIR
ASIVPQNYYTFDSEGIVKNLTCKRSPQHFKPYLTPNLPKRFHYANNIRIDKVHLLVDRQW
LAVRDNSYTFCDQGNHGYDNEFKSMEAIFLGYGPSFKEKTEVDAFENIEVYNLMCDLLHI
TPAPNNGTHGSLNHLLKKPFYNPSYAKEESSPVSCPVSHLNPIDELGCTCKDVSNASVIN
KRLNLTADEIKNATSYNLPYGRPQVLQKENIYCLLPHHQYVSGYSHDIWMPLWTAYTVTK
PESTSSLPPTVSDCLRADVRIPVAHSQNCSNYPEGLDLTYGFLYPPNFNSSALEQYDALL
TSNIVPMYRAFRDIWDYFHDVLLQKYARERNGVNVISGPVFDYNYDGHFDTLDEITQHVN
NTQIPVPTHYFVVLTSCKDTSYTPLNCTGSLDALSFIIPHRPDNTESCADNRSPSEWVEE
RVQAHSARVRDVELLTGLDFYQERQGPVSEILQLKTFLPTFETEIN
Download sequence
Identical sequences ENSGALP00000004559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]