SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004651 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004651
Domain Number 1 Region: 113-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.36e-48
Family Hypothetical protein AT3g04780/F7O18 27 0.000074
Further Details:      
 
Domain Number 2 Region: 5-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.01e-22
Family Thioltransferase 0.00000676
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004651   Gene: ENSGALG00000002948   Transcript: ENSGALT00000004660
Sequence length 289
Comment pep:known_by_projection chromosome:Galgal4:Z:593093:607740:1 gene:ENSGALG00000002948 transcript:ENSGALT00000004660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGVKLIANDTEFQPELSAAGSRLAVVKFTMRGCGPCLRIAPAFNALSNKYPQATFLEVD
VHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGNNEDTDIP
KGYMDLMPFINKAGCECLNESDEHGFDNCLRKDSTYLESDCDEQLLITVAFSQPVKLYSM
KLQGPDNGQGPKYIKIFINLPRSMDFEEAERSEPTQALELTPDDIKEDGIIQLRYVKFQN
VNSVTLFVQSNHGDEETTRITYFTFIGTPVQATNMNDFKRVVGKKGESH
Download sequence
Identical sequences A0A182C605 A0A1D5NUH1
9031.ENSGALP00000004651 ENSGALP00000004651 ENSGALP00000004651 XP_010723427.1.16129 XP_015742717.1.68032 XP_424463.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]