SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004756 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004756
Domain Number 1 Region: 424-685
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.33e-81
Family Eukaryotic proteases 0.00000788
Further Details:      
 
Domain Number 2 Region: 19-133
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.19e-32
Family Spermadhesin, CUB domain 0.00000466
Further Details:      
 
Domain Number 3 Region: 180-293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-27
Family Spermadhesin, CUB domain 0.00000574
Further Details:      
 
Domain Number 4 Region: 297-366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000101
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 363-434
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.0000766
Further Details:      
 
Domain Number 6 Region: 132-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000479
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004756   Gene: ENSGALG00000003016   Transcript: ENSGALT00000004765
Sequence length 687
Comment pep:known chromosome:Galgal4:21:4073317:4086699:-1 gene:ENSGALG00000003016 transcript:ENSGALT00000004765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLLLLAVLCGGANSSIVLQKMYGRITSPDFPNNYPNHKERTWNVTVPKGYAVRIYFTH
FNLELSYQCEYDYVKLSSSGKTLATLCGQDSTDTEEAPGNKTYISIDNTLTVVFRSDYSN
EKPFTGFEAFYAAEDIDECKQLFDGEPLCSHHCHNYVGGYYCSCRIGYVLHENKRTCTAQ
CQNQIFTQRTGEIASPDYPAPYPPLSTCSYNIQVEDGFLITLEFVETFNVETHPEVLCPY
DVLKMETPKKQFGPFCGKTLPAKIETQTNVVNITFITDVSGAHTGWKVKYTAVGLPCPSP
EAPPYGHIAPVQAQYTVGDHYALSCDVGYVLLENENVVMSFVAECEKNASWNKPMAKCII
VDCGQPEDIDSGAILYLTGPEKTTYSAAIQYQCAAPFYTMRANSSGKYICSDDGFWKNTE
GEITLPVCEPVCGMQRMRALERIYGGRRANPGQFPWQVMLITEHGELGSGSLLYDSWVLT
AAHVVAEQRNPSTLRIKLGILNRYSVHYEEVHAVKIFIHEGYKNDLVNFDNDIALIKLER
KVPVSTTISPICLPGKEEFQIKANDTVTVAGWGRTETRSSSVVLLYTELMIINQKECADA
YANKSHSGNPLVITENMLCAGAEEGGRDACHGDSGGPLVVLDAQTRKWFVIGIVSWALDC
AVAGQYGVYTRVMNYMPWIESTITNNS
Download sequence
Identical sequences ENSGALP00000004756 XP_015152332.1.86415 ENSGALP00000004756 9031.ENSGALP00000004756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]