SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004783 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004783
Domain Number 1 Region: 78-281
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.34e-44
Family Reprolysin-like 0.0022
Further Details:      
 
Domain Number 2 Region: 375-431
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 7.46e-17
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 1051-1115
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000471
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 1279-1390
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000602
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 5 Region: 932-997
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000419
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 6 Region: 728-794
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000353
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 7 Region: 674-734
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000262
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 8 Region: 1170-1264
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000641
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 9 Region: 1001-1057
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000196
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000004783
Domain Number - Region: 606-678
Classification Level Classification E-value
Superfamily Fungal immunomodulatory protein, FIP 0.0942
Family Fungal immunomodulatory protein, FIP 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004783   Gene: ENSGALG00000003028   Transcript: ENSGALT00000004792
Sequence length 1394
Comment pep:known_by_projection chromosome:Galgal4:17:6906389:6925818:1 gene:ENSGALG00000003028 transcript:ENSGALT00000004792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGAGCAACGTSPCLAVRPRGSGWAEVWRAKNVKLSFFLQRFLRALDADDVFSYFGTSSVS
DAGHFAPRLQKRADGAVKHLELMVVAGPDVYMYHQEDTERYILTNLNIGAELLRDASLGA
HFRVHLMQMLVLREPEVNVNITTNITSSLISVCEWSKKVNPQNDSDPQHADIVLYVTRFD
LQLPDGNKELRGVTRLGGVCSSSWSCVITQDTGFDLGVTIAHEIGHSLGIPHDGEGNQCS
SSGFIMGSAGNRNSVDLIWSQCSREEFLAFVSTGQTNCLNDLPDMDGSIPGWKPGLYYGA
DEQCKIAFGSVATACTFADSNVDICKVLSCHVQPGDKSSCTRLLVPLLDGTECGVNKWCS
KGQCSSLTELNPMAVVHGQWSSWSPFSSCSRSCGGGVQIRQRFCNNPRPAFGGKECQGAS
IQAEMCNTQACLMTQLDFMAEQCAATNLKPLYLTVGVPSFYTWTSAVGFAKGDTQCKHMC
RTIEDEFMVSREDSFIDGTRCEPDNSEDGTFHLCVAGSCRAFGCDGQMNSKRAMDSCKVC
GGDNTTCMEVSGSYTEGKAKEYVTFLSLPYNATSVHVINQRPLFTHLAVKVKGEYVVAGK
GKISLNVTYPSVLEDRQIEYKVFLTNHNLPSLEEIHVDGPIQEEIEIQVYRRYAKEYGDA
TNPDITFSYFVPKENLTYRWIPHEGPCSVTCGGGTQLVNYVCFDQMKNEITENQLCLGLL
QPLPGYEPCAVEPCPYRWKISQTDECSAVCGSGVAQQNLTCVQFHNGSETVVDDSLCSAR
EKPLSIVPCVVNVCPLGWDRGGSDVGGKTANREEGFSAMDHRCKSILENLCQVYAYRGEE
TALGISLQSRVSIQPQLCSEEEDMDLLRTLELPGHIQLENQSVYVWSPLPGECSVSCGRG
EIPQCCKKMLPGKTQEENCHPVAKPESRLEDCNLSPCPPRWHYKMGSCSVSCGGGVMQKV
LYCARETREKEEEIVADVQCDGLPRPEEQEPCNLEPCPPRWKVTPGGPCSSSCGLGLSVQ
LVTCVQIQQGKEILLEQHSCPVSEKPLTTIPCVIRMCSYEWSFSEWTECSTSCGNGVQTR
HNFCLNRLTHKHVNPIFCRRFPKAIVLRGCSAGPCPEQGVDSRLHGAELQTVTPAMHLMT
TADAEGPRYKGLILPSSALPAVLQEQIKETREGVCGKLFLNTSGIINMTGVESSDCTVAI
GRPLGEEITINVLESSLNCSAGEVVLFSGRMMWRTGCRKLTLSLINSRTNTLIVKQRVLL
PGNGVVLQYNSRNAIKKYYQECDKQLFGPHGEIVNPTQSPGQKQEVVCRTFINVAPQHHI
AIRGLYVDLSHESNQTHFNYILIRDVSTMKTMVFRGKQQFFWQSTGSQAEIEFHENIKDH
QTRFWAEYHAAEPK
Download sequence
Identical sequences ENSGALP00000004783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]