SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004835 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004835
Domain Number 1 Region: 508-736
Classification Level Classification E-value
Superfamily SET domain 1.18e-61
Family Histone lysine methyltransferases 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000004835
Domain Number - Region: 432-471
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000258
Family Myb/SANT domain 0.022
Further Details:      
 
Domain Number - Region: 96-175
Classification Level Classification E-value
Superfamily CalX-like 0.00235
Family CalX-beta domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004835   Gene: ENSGALG00000003068   Transcript: ENSGALT00000004844
Sequence length 746
Comment pep:known_by_projection chromosome:Galgal4:27:5014569:5026656:-1 gene:ENSGALG00000003068 transcript:ENSGALT00000004844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIATPPTSKCIIYWKRKVKSEYMRLRQLKRFQANMGAKALFVANFAKVHEKTRILNEDW
KKLRVQPVQLMKPVSGHPFLKQCTVESIFPGFPSQTLYMRTLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMISGSVLISDAVFLELV
NALNQYSDEEEEGHNDSEAKQEDGKEELPVTRKRKRIAVEGNKKCSKKRFPNDMIFTAIS
SMFPEYGFPDDMKERYRELTEVSDPNVLPPQCTPNIDGPCAKSVQREQSLHSFHTLFCRR
CFKYDCFLHPFHATPNVYKRKNRETKIEPDPCGADCFLWLEGAKEFAALHNPRSKCSGRR
RRRHHVVSASCSNAPASAVAETREGDSDRDTGNEWASSSSEANSRCQTPTKQKLSPTSSQ
LFAVEAQQEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLITKL
PTNELMNPSQKKKRKHRLWAAHCRKIQLKKDNSPTQVYNYQPCDHPEHPCDSSCPCIMTQ
NFCEKFCQCNPDCKNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVVS
CKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDK
YMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAGE
ELFFDYRYSQADALKYVGIERETDII
Download sequence
Identical sequences ENSGALP00000004835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]