SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000004912 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000004912
Domain Number 1 Region: 1412-1524
Classification Level Classification E-value
Superfamily C-type lectin-like 4.94e-46
Family Noncollagenous (NC1) domain of collagen IV 0.00000363
Further Details:      
 
Domain Number 2 Region: 1300-1409
Classification Level Classification E-value
Superfamily C-type lectin-like 8.48e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000004912   Gene: ENSGALG00000003115   Transcript: ENSGALT00000004921
Sequence length 1526
Comment pep:known_by_projection chromosome:Galgal4:9:8873716:8915386:1 gene:ENSGALG00000003115 transcript:ENSGALT00000004921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFCLIYLIVQGCPADGYDQGYGAKGDPGFPGIPGPQGAQGVQGYPGETGPRGLPGTSGI
PGRPGPPGPKGLMGMKVIGTKGRKGDTGLTGPPGPPGTVIVTLSGPDNMTDLKGEKGEKG
SRGLPGPMGFTGPTGDSQSEKGDRGEPGAQGKPGKEGAPGLPGLPGQHGEQGKPGLAGRQ
GAKGVKGDTGPPGACGRTEYYDVVGEKGDEGPPGPPGPKGQRGMPGPQGPPGDAGRPGVS
RPGLRGPPGFPGPKGTKGEKGQEGSCIVGPPGLPGITGRIGSAGLPGPPGEPGRVTFRTG
PPGLPGQPGCAGPPGPPGDIGMKGDEACMCTDCSYIPGTPGLPGSPGPRGQDGIPGREGT
PGPKGAPGSPGAPGFPGPQGPPGFKGDQGRKGSKGEPGYVYPEGPKGEQGDPGARGDKGR
KGSSGFLGRPGSKGHKGSKGEEGLAGSKGDRGQPGLPGNPGLPGEMGLPGLPGYGPQGIR
GVKGSKGLPGPHGLPGEAGLKGETIRIAPLPALPGPQGPDGLPGSPGVPGRVGTSGQPGD
VGHPGPTGDTGFPGLGFPGNPGPKGNKGLPGGRGAPGCEGKMGEPGRAGNLGQPGEKGDP
GIIIPGEPGKLGSPGGRGIPGPKGDTGFPGLPGLPGHAGRDGNSGLRGDPGSSGVPGDPG
FPGKPAECLTGLPGLPGVQGATGPPGRRGSLGSKGKLGPPGLGIPGIYGKPGEPGLIGLL
GNTGLPGLKGQSGRPGVSGVPGPRGEPGIMGPLGIPGPPGRIGSPGNPGIRGSFGFPGLK
GRKGLLGAQGEPGDKGFPGPSETLVVIGNKGEQGSKGVQGRMGLKGEKGDAGVQGPPGLI
GSEGVPGVPGVKGFMGLPGIPGGQGFPGAPGNKGNMGIPGQKGQKGSPGFPGTSGDPGPT
GYGGFPGEKGDPGYPSPGLPGEPGPKGDPGAPGVLGRKGEKGSQGQPGHNGAPGLHGPRG
ETGVAGNPGKLGLPGYVGVKGQQGHPGQQGVIGPPGAAGYPGENGLAGERGNQGQDGMPG
PPGAKGEPGAPGRGIPGLQGVPGRRGVKGDMGLPGFPGPPGMKGLQGDQGPLGPPGLMGL
PGFQGATGMAITGPKGNRGIAGADGRPGIPGFQGLPGLPTMSIKGSKGVRGADGIQGPMG
PAGDSGPPGPKGVEGRPGYPGARGDPGFLGFPGVKGEKGNQGPPGPRGAEGPRGPKGQPG
PPGVSERIFSVPGSKGPPGLPGIPGTPGDQGVQGIPGLQGPKGVKGLPGSFGRPGQPGRP
GPKGDRGFPGQRGQPGLIGFPGLQGLPGSPGTITTGPTRRGFIFTRHSQSTKIPSCPSGT
SQIYFGYSLLFVQGNERAHGQDLGTAGSCLQRFTTMPFLFCNTNDVCSFASRNDYSYWLS
TATAMPVDMAPISGKALEPHISRCIVCEGPAMVIAVHSQTTAVPACPGGWISLWKGFSFV
MYTSAGSEASGQALASPGSCLEEFRAIPFIECHGRGTCNYYTNSYSFWLASLNPRRMFRK
PMPQTLKAGELENIISRCQVCMKRPV
Download sequence
Identical sequences ENSGALP00000004912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]