SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005644 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005644
Domain Number 1 Region: 23-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-54
Family Motor proteins 0.0000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005644   Gene: ENSGALG00000003571   Transcript: ENSGALT00000005654
Sequence length 247
Comment pep:known_by_projection chromosome:Galgal4:19:5637919:5639311:1 gene:ENSGALG00000003571 transcript:ENSGALT00000005654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKDRGGKDGGGSLSPGEEQDGRETRLRVVLRVRPLTCTETRRGDRHVVRSLGNGTVHVSA
ARHDATFTFSAVFDASASQEAVFEGSGMRQLVELAVEGFSCTVFAYGQTGSGKTYTLMGP
LGQSDAPGLLGLMQRSFSFLLEQSRGAGLALSASYLEIYNEQVRDLLSAGPPRALPLRWS
KTRGFYVENQLSVDFESLEAVVELLLQAGSQRRRTSAHALNGHSSRSHAILTIRIHSRAV
SPSPTVG
Download sequence
Identical sequences ENSGALP00000005644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]