SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005653 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005653
Domain Number 1 Region: 1481-1656
Classification Level Classification E-value
Superfamily Fibronectin type III 3.16e-29
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 2 Region: 1301-1470
Classification Level Classification E-value
Superfamily Fibronectin type III 4.36e-24
Family Fibronectin type III 0.0000168
Further Details:      
 
Domain Number 3 Region: 1847-2016
Classification Level Classification E-value
Superfamily Fibronectin type III 1.68e-23
Family Fibronectin type III 0.0000211
Further Details:      
 
Domain Number 4 Region: 941-1108
Classification Level Classification E-value
Superfamily Fibronectin type III 3.54e-23
Family Fibronectin type III 0.00096
Further Details:      
 
Domain Number 5 Region: 1666-1836
Classification Level Classification E-value
Superfamily Fibronectin type III 1.83e-22
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 757-923
Classification Level Classification E-value
Superfamily Fibronectin type III 6.82e-22
Family Fibronectin type III 0.00065
Further Details:      
 
Domain Number 7 Region: 441-496
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-21
Family Fibronectin type II module 0.0000556
Further Details:      
 
Domain Number 8 Region: 1124-1290
Classification Level Classification E-value
Superfamily Fibronectin type III 2.26e-18
Family Fibronectin type III 0.0000164
Further Details:      
 
Domain Number 9 Region: 590-635
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000113
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 10 Region: 2237-2280
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000183
Family Fibronectin type I module 0.0014
Further Details:      
 
Domain Number 11 Region: 548-592
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000458
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 12 Region: 500-541
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000127
Family Fibronectin type I module 0.0023
Further Details:      
 
Domain Number 13 Region: 320-364
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000013
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 14 Region: 2192-2235
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000131
Family Fibronectin type I module 0.0042
Further Details:      
 
Domain Number 15 Region: 183-228
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000262
Family Fibronectin type I module 0.00014
Further Details:      
 
Domain Number 16 Region: 648-733
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000454
Family Fibronectin type III 0.0000109
Further Details:      
 
Domain Number 17 Region: 274-319
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000458
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 18 Region: 139-180
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00037
Further Details:      
 
Domain Number 19 Region: 231-271
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000641
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 20 Region: 2280-2321
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000222
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 21 Region: 399-437
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000131
Family Fibronectin type I module 0.00046
Further Details:      
 
Domain Number 22 Region: 2105-2171
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000317
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005653   Gene: ENSGALG00000003578   Transcript: ENSGALT00000005663
Sequence length 2360
Comment pep:known chromosome:Galgal4:7:4333468:4382817:-1 gene:ENSGALG00000003578 transcript:ENSGALT00000005663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPLPLSAPRPFVAAGGAAPHSARRGGGGPRPSPGGSEGQWAPGRRRLLPPAPPAVYSA
RAAALRPSGCLRAAPFLAQIPVLRAVPRMPGRGGLRLALLALCLGAAAAGGGDGQRRGGK
NRRQAQTASVPQATPAQGKQTCFDNGRYYQINQQWERIYLGNTLVCTCYGGSRGFNCESK
PEPEETCFDKYTGSTYRVGETYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGKSYKI
GDTWRRPHETGGYLLECVCLGNGKGEWTCKPLAERCYDNTAGTSYVVGETWEKPYQGWMM
VDCTCLGEGSGRITCTSRNRCNDQDTKTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWKC
ERHTSLHTTSTGSGSPSFTNVQTALYQPQPQQPQPQPHGHCVTDNGVVYSLGMQWLKTQG
SQQMLCTCLGNGVSCQEIVLVQTRGGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCG
TTENYDADQKFGFCPMAAHEEICTTNDGIMYRVGDQWDKQHDMGHMMRCTCVGNGRGEWT
CIAYSQLRDQCIVDGITYDVNQTFHKRHDEGHMLNCTCFGQGRGRWKCDPVDQCQDSETR
TFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQAYAGATGPVQVIITESTNQPNSHP
IQWNAPKTSHISKYILRWRPKISGRHWKEATIPGHLNSYTISGLKPGVVYEGQLISVQQH
GPKEVTRFDFTTTSTTAVTSNTVSGETTLLPPMVATSESVTEITASSFVVSWVSASDTVS
GFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEEGEQNLILSTSQT
TAPDAPPEHSVESVDDTSIVISWSRPQAPITGYRIVYTPSVEGSSTELNLPDTATSVTLS
DLMPGVQYNISIYAVEEHQESTPVFIQQETTGVPRTDEVPSPKDLQFVEVSDVKVTIMWT
PPQSQVSGYRVEAIPVNRPGQHGQRLPITRSSFAEVVDLLPGTTYLFKIFAVSHGRESKP
LTGEQTTKLDAPTNLRFINTTEHSVLVLWTRPRAIISGYRLTAGPTRGGQPRTYNVGPSA
TKYLLRNLQPGTEYTVYLVAVKEDLQSARETGVFTTYQPVGSVPPFNTEVTETSIVITWT
PAPRIGFKLGVRPSQGGEAPREVISDSGSIVISGLTPGVEYTYSLTVLMDGQERETPIIR
RVTTPLSPPTNLRLEPNPDTGILIVSWDRSTTPGISGYRVTTAPTNGQQGSTLEEVVGAD
QTSCTFENLNPGVEYNVSVYAVKDDQESIPISKTITQAVPPPTDLRFTNVGPDTMRVTWT
APTSIVLSSFLVRYSPVKKEEDVAELTISPSDNVVVLTNLLPGTEYLVRVYSVAEQHESA
PLSGIQKTGLDSPTGLDFSDITANSFTVHWIAPRATITGYKIRHHPEHGVGRPKEDRVPP
SRNSITLTNLLPGTEYVVSIIAVNGREESVPLVGQQTTVSDVPRDLEVNPTSPTSLEISW
DAPAVTVRYYRITYGETGGSSPVQEFTVPGTMSRATITGLKPGVDYTITVYAVTGRGDSP
ASSKPVTVTYKTEIDTPSQMQVTDVQDNSISIRWLPSSSPVTGYRVTAVPKKGHGPTKTK
NVPPDQTQVTIEGLQPTVEYMVSVYAQNQNGESLPLVETAVTNIDRPKGLTFTEVDVDSI
KIAWESPQGQVTRYRVTYSSPEDGIHELLPAPGGEEDTAELHGLRPGSEYTINIVAIYDD
MESLPLTGTQSTAIPPPTNLKFTQVTPTSLTVNWNAPNVRLTGYRVRVNPKEKTGPMKEI
NLSPDSTSAVVSGLMVATKYEVSVYALKDSLTSRPAQGVVTTLENVSPPRRARVTDATET
TITITWRTKTETITGFQIDAIPAASGQNPIQRTISPDVRTYTITGLQPGNDYKIYLYTLN
ENARSSPVVIDASTAIDAPSNLRFLTTTTNSLLASWQPPRAKITGYIIRYDKPGSPAKEL
LPRPRPGTTEATITGLEPGTEYTIYIIAVKNNQKSEPLVGRKRTDDLPTLITGPHPNQPD
MLDVPSVDEGTPYLTNNRPGSRRQPPNVDEAIEIPGYQVPIIVVPSYPHSREPRRNDTTG
QEALSQTTISWRPLLESTEYIISCQPVSQDEDTLQFRVPGTSSSATLTGLTRGATYNIIV
EALKDHRRQKVLEEVVTVGNTVSEGLNQPADDTCYDTYTGSFYSIGEEWERLSETGFKLW
CQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCEPHE
TTCYDDGKMYQVGEQWQKEYFGAICSCTCYGGQQGWRCDNCRRPSVEVAPEGSAGHTYPQ
FTQRYHQATNTEEDHYSDLE
Download sequence
Identical sequences ENSGALP00000005653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]