SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005654 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005654
Domain Number 1 Region: 1544-1718
Classification Level Classification E-value
Superfamily Fibronectin type III 3.67e-29
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 2 Region: 913-1080
Classification Level Classification E-value
Superfamily Fibronectin type III 3.54e-23
Family Fibronectin type III 0.00096
Further Details:      
 
Domain Number 3 Region: 1910-2079
Classification Level Classification E-value
Superfamily Fibronectin type III 6.32e-23
Family Fibronectin type III 0.0000211
Further Details:      
 
Domain Number 4 Region: 1729-1899
Classification Level Classification E-value
Superfamily Fibronectin type III 2.05e-22
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 5 Region: 1275-1444
Classification Level Classification E-value
Superfamily Fibronectin type III 3.53e-22
Family Fibronectin type III 0.0000244
Further Details:      
 
Domain Number 6 Region: 729-895
Classification Level Classification E-value
Superfamily Fibronectin type III 7.3e-22
Family Fibronectin type III 0.00065
Further Details:      
 
Domain Number 7 Region: 413-468
Classification Level Classification E-value
Superfamily Kringle-like 5.42e-21
Family Fibronectin type II module 0.0000556
Further Details:      
 
Domain Number 8 Region: 1452-1541
Classification Level Classification E-value
Superfamily Fibronectin type III 7.38e-21
Family Fibronectin type III 0.00000657
Further Details:      
 
Domain Number 9 Region: 352-408
Classification Level Classification E-value
Superfamily Kringle-like 2.57e-20
Family Fibronectin type II module 0.0001
Further Details:      
 
Domain Number 10 Region: 1096-1262
Classification Level Classification E-value
Superfamily Fibronectin type III 2.02e-18
Family Fibronectin type III 0.0000164
Further Details:      
 
Domain Number 11 Region: 562-607
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000119
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 12 Region: 2345-2388
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000196
Family Fibronectin type I module 0.0014
Further Details:      
 
Domain Number 13 Region: 520-564
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000484
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 14 Region: 232-276
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000131
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 15 Region: 476-516
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000131
Family Fibronectin type I module 0.0022
Further Details:      
 
Domain Number 16 Region: 2300-2343
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000144
Family Fibronectin type I module 0.0042
Further Details:      
 
Domain Number 17 Region: 95-140
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000275
Family Fibronectin type I module 0.00014
Further Details:      
 
Domain Number 18 Region: 620-705
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000047
Family Fibronectin type III 0.0000109
Further Details:      
 
Domain Number 19 Region: 186-231
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000484
Family Fibronectin type I module 0.00019
Further Details:      
 
Domain Number 20 Region: 51-92
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000262
Family Fibronectin type I module 0.00038
Further Details:      
 
Domain Number 21 Region: 143-183
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000068
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 22 Region: 2388-2429
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000236
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 23 Region: 311-349
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000144
Family Fibronectin type I module 0.00046
Further Details:      
 
Domain Number 24 Region: 2213-2279
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000333
Family Fibronectin type III 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005654   Gene: ENSGALG00000003578   Transcript: ENSGALT00000005664
Sequence length 2483
Comment pep:known chromosome:Galgal4:7:4333533:4382616:-1 gene:ENSGALG00000003578 transcript:ENSGALT00000005664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRGGLRLALLALCLGAAAAGGGDGQRRGGKNRRQAQTASVPQATPAQGKQTCFDNGRY
YQINQQWERIYLGNTLVCTCYGGSRGFNCESKPEPEETCFDKYTGSTYRVGETYERPKDS
MIWDCTCIGAGRGRISCTIANRCHEGGKSYKIGDTWRRPHETGGYLLECVCLGNGKGEWT
CKPLAERCYDNTAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTKT
SYRIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLHTTSTGSGSPSFTNVQTALYQP
QPQQPQPQPHGHCVTDNGVVYSLGMQWLKTQGSQQMLCTCLGNGVSCQEIAVTQTYGGNS
DGEACVLPFTYNGRTFYSCTTEGRTDGHLWCSTTSNFEQDRRYSFCTEQNVLVQTRGGNS
NGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTENYDADQKFGFCPMAAHEEICTTNDG
IMYRVGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDGITYDVNQTFHKRH
DEGHMLNCTCFGQGRGRWKCDPVDQCQDSETRTFYQIGDSWEKYVHGVRYQCYCYGRGIG
EWHCQPLQAYAGATGPVQVIITESTNQPNSHPIQWNAPKTSHISKYILRWRPKISGRHWK
EATIPGHLNSYTISGLKPGVVYEGQLISVQQHGPKEVTRFDFTTTSTTAVTSNTVSGETT
LLPPMVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVN
IPDLLPGRKYIVNVYQISEEGEQNLILSTSQTTAPDAPPEHSVESVDDTSIVISWSRPQA
PITGYRIVYTPSVEGSSTELNLPDTATSVTLSDLMPGVQYNISIYAVEEHQESTPVFIQQ
ETTGVPRTDEVPSPKDLQFVEVSDVKVTIMWTPPQSQVSGYRVEAIPVNRPGQHGQRLPI
TRSSFAEVVDLLPGTTYLFKIFAVSHGRESKPLTGEQTTKLDAPTNLRFINTTEHSVLVL
WTRPRAIISGYRLTAGPTRGGQPRTYNVGPSATKYLLRNLQPGTEYTVYLVAVKEDLQSA
RETGVFTTYQPVGSVPPFNTEVTETSIVITWTPAPRIGFKLGVRPSQGGEAPREVISDSG
SIVISGLTPGVEYTYSLTVLMDGQERETPIIRRVTTPLSPPTNLRLEPNPDTGILIVSWD
RSTTPGISGYRVTTAPTNGQQGSTLEEVVGADQTSCTFENLNPGVEYNVSVYAVKDDQES
IPISKTITQEVPQLTDLSFVDITDSSIGLRWTPLNASTIIGYRITVVAAGESVPIFEDFV
DSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRV
TWTAPTSIVLSSFLVRYSPVKKEEDVAELTISPSDNVVVLTNLLPGTEYLVRVYSVAEQH
ESAPLSGIQKTGLDSPTGLDFSDITANSFTVHWIAPRATITGYKIRHHPEHGVGRPKEDR
VPPSRNSITLTNLLPGTEYVVSIIAVNGREESVPLVGQQTTVSDVPRDLEVNPTSPTSLE
ISWDAPAVTVRYYRITYGETGGSSPVQEFTVPGTMSRATITGLKPGVDYTITVYAVTGRG
DSPASSKPVTVTYKTEIDTPSQMQVTDVQDNSISIRWLPSSSPVTGYRVTAVPKKGHGPT
KTKNVPPDQTQVTIEGLQPTVEYMVSVYAQNQNGESLPLVETAVTNIDRPKGLTFTEVDV
DSIKIAWESPQGQVTRYRVTYSSPEDGIHELLPAPGGEEDTAELHGLRPGSEYTINIVAI
YDDMESLPLTGTQSTAIPPPTNLKFTQVTPTSLTVNWNAPNVRLTGYRVRVNPKEKTGPM
KEINLSPDSTSAVVSGLMVATKYEVSVYALKDSLTSRPAQGVVTTLENVSPPRRARVTDA
TETTITITWRTKTETITGFQIDAIPAASGQNPIQRTISPDVRTYTITGLQPGNDYKIYLY
TLNENARSSPVVIDASTAIDAPSNLRFLTTTTNSLLASWQPPRAKITGYIIRYDKPGSPA
KELLPRPRPGTTEATITGLEPGTEYTIYIIAVKNNQKSEPLVGRKRTDDLPTLITGPHPN
QPDMLDVPSVDEGTPYLTNNRYDNGNGIQLPGTSGHPQTIGHQGQQVFFEEHGYRRPVPT
TATPLRPGSRRQPPNVDEAIEIPGYQVPIIVVPSYPHSREPRRNDTTGQEALSQTTISWR
PLLESTEYIISCQPVSQDEDTLQFRVPGTSSSATLTGLTRGATYNIIVEALKDHRRQKVL
EEVVTVGNTVSEGLNQPADDTCYDTYTGSFYSIGEEWERLSETGFKLWCQCLGFGSGHFR
CDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCEPHETTCYDDGKMYQV
GEQWQKEYFGAICSCTCYGGQQGWRCDNCRRPSVEVAPEGSAGHTYPQFTQRYHQATNTN
VNCPIECFMPLDVQADTQHPRGK
Download sequence
Identical sequences F1NJT3
NP_001185641.1.86415 ENSGALP00000005654 ENSGALP00000005654 9031.ENSGALP00000005654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]