SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005656 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005656
Domain Number 1 Region: 465-663
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.06e-70
Family Hemopexin-like domain 0.0000000165
Further Details:      
 
Domain Number 2 Region: 86-215,388-442
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.87e-37
Family Matrix metalloproteases, catalytic domain 0.000000504
Further Details:      
 
Domain Number 3 Region: 274-331
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-21
Family Fibronectin type II module 0.0000752
Further Details:      
 
Domain Number 4 Region: 334-390
Classification Level Classification E-value
Superfamily Kringle-like 8.85e-21
Family Fibronectin type II module 0.0000948
Further Details:      
 
Domain Number 5 Region: 38-104
Classification Level Classification E-value
Superfamily PGBD-like 3.92e-20
Family MMP N-terminal domain 0.0000322
Further Details:      
 
Domain Number 6 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 1.08e-19
Family Fibronectin type II module 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005656   Gene: ENSGALG00000003580   Transcript: ENSGALT00000005666
Sequence length 663
Comment pep:known chromosome:Galgal4:11:3182494:3220410:-1 gene:ENSGALG00000003580 transcript:ENSGALT00000005666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTHSVFGFFFKVLLIQVYLFNKTLAAPSPIIKFPGDSTPKTDKELAVQYLNKYYGCPKD
NCNLFVLKDTLKKMQKFFGLPETGDLDQNTIETMKKPRCGNPDVANYNFFPRKPKWEKNH
ITYRIIGYTPDLDPETVDDAFARAFKVWSDVTPLRFNRINDGEADIMINFGRWEHGDGYP
FDGKDGLLAHAFAPGPGIGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFWFNGKE
YNSCTDAGRNDGFLWCSTTKDFDADGKYGFCPHESLFTMGGNGDGQPCKFPFKFQGQSYD
QCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFIFLGNKYDSC
TSAGRNDGKLWCASTSSYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSEDPGALMAP
IYTYTKNFRLSQDDIKGIQELYEVSPDVEPGPGPGPGPGPRPTLGPVTPELCKHDIVFDG
VAQIRGEIFFFKDRFMWRTVNPRGKPTGPLLVATFWPDLPEKIDAVYESPQDEKAVFFAG
NEYWVYTASNLDRGYPKKLTSLGLPPDVQRIDAAFNWGRNKKTYIFSGDRYWKYNEEKKK
MELATPKFIADSWNGVPDNLDAVLGLTDSGYTYFFKDQYYLQMEDKSLKIVKIGKISSDW
LGC
Download sequence
Identical sequences Q90611
9031.ENSGALP00000005656 ENSGALP00000005656 ENSGALP00000005656 NP_989751.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]