SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005957 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005957
Domain Number 1 Region: 208-458
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-68
Family Nuclear receptor ligand-binding domain 0.000000000525
Further Details:      
 
Domain Number 2 Region: 15-100
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-32
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005957   Gene: ENSGALG00000003759   Transcript: ENSGALT00000005967
Sequence length 469
Comment pep:known chromosome:Galgal4:10:4513260:4533758:1 gene:ENSGALG00000003759 transcript:ENSGALT00000005967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VINWLCASVAAQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNC
LIDRTSRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQ
PGEAEPLTPTYNITTNGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLD
INGIKPEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHMETCQYLREEL
QQITWQTFLQEEIENYQNKQREVMWQLCAVKITEAIQYVVEFAKRIDGFMELCQNDQIVL
LKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPEVFKSLAGCEDFISFVFEFGKSLCSMH
LTEDEIALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKV
STLRALCGRHTEKLIAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Download sequence
Identical sequences ENSGALP00000005957 ENSGALP00000005957 9031.ENSGALP00000005957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]