SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000005983 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000005983
Domain Number 1 Region: 26-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.04e-40
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 2 Region: 263-328
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000418
Family VWC domain 0.016
Further Details:      
 
Domain Number 3 Region: 471-580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000424
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 4 Region: 423-464
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 678-750
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000241
Family VWC domain 0.021
Further Details:      
 
Domain Number 6 Region: 585-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000137
Family EGF-type module 0.021
Further Details:      
 
Domain Number 7 Region: 330-387
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000023
Family VWC domain 0.029
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000005983
Domain Number - Region: 388-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0171
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 762-798
Classification Level Classification E-value
Superfamily FnI-like domain 0.0241
Family VWC domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000005983   Gene: ENSGALG00000003777   Transcript: ENSGALT00000005993
Sequence length 806
Comment pep:known_by_projection chromosome:Galgal4:5:2243250:2526700:1 gene:ENSGALG00000003777 transcript:ENSGALT00000005993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTQRISIWMCFTAVGFGMDPDLQIDIITELDLVNTTIGVTQVPGLHNASKAFLFQDVE
REIHAAPHVSEKLVHLFRNKSEFTFLVTLQQKTSTSGVILSIRELEHSYFELESSGLRDE
IRYHYRFNGKSRTEVFPYRLADGQWHRIAVSLSASHLLLHVDCNRIYERIIDPPETNLIP
ESNLWLGQRNRKHGFFKGVIQDVKVVFIPNGYITQCPNLNRTCPTCSDFLSLVQGIMDLQ
ELLAKMTAKLNYAEARLSRLEDCHCEKTCQVNGLIYRDKDSWFEDDHCRNCTCKSGVVEC
RRMSCPPLDCPPDALPVHVDSQCCKVCKAKCIYGGKVLAEGQRVLAKSCRECQNGVLVKV
TETCPPLNCSEKDHVLPENQCCSVCRGHNFCAEGHRCGENSECKNWNTKATCECKNGYLS
VQGDSAYCEDIDECAAKMHYCHANTMCVNLPGSYRCDCVRGYVRVDDFSCTEHDECGSGR
HNCDENAICTNSVRGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCVCPSGFTGN
HCEKDIDECAEGIIECHNHSRCVNLPGWYHCECRSGFHDNGSYSLSGESCVDIDECALKT
HTCWNDSACVNLAGGFDCLCPSGPSCTGDCLHEGGFKRNGQVWTLREDRCSVCSCKDGKI
FCRRTACDCENPSADLFCCPECDTRVTSQCLDQTGHKLYRSGDNWTYSCQQCRCLEGEVD
CWPLLCPNLNCEYTATSEGECCPHCVSDPCLADNITYDIRKTCLDGYGITRLSGAVWTMV
GSPCTTCKCKNGSVCCSVDLECLNNN
Download sequence
Identical sequences ENSGALP00000005983 XP_001234167.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]