SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006298 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006298
Domain Number 1 Region: 287-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.31e-20
Family Complement control module/SCR domain 0.0000593
Further Details:      
 
Domain Number 2 Region: 107-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.06e-19
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 3 Region: 229-291
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000433
Family Complement control module/SCR domain 0.00044
Further Details:      
 
Domain Number 4 Region: 46-117
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000354
Family Complement control module/SCR domain 0.00031
Further Details:      
 
Domain Number 5 Region: 164-238
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000197
Family Complement control module/SCR domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006298   Gene: ENSGALG00000003957   Transcript: ENSGALT00000006308
Sequence length 374
Comment pep:known chromosome:Galgal4:18:7724174:7733771:1 gene:ENSGALG00000003957 transcript:ENSGALT00000006308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAFTFKGGTTGLRVTGEAGGLAAMYSLALLLCAAALTHSALAVKVCPRPPEVLFATINV
VKNEYNVGEEIEYTCRPGFVPNSGQRKYICQPTGRWPLNTLLCLPKRCPAPAPLQHGTID
SRDFHYRSSLSFSCDPGYSLVGSRTSQCMSDGKWSGIPPQCQPVTCAPPSLPEFGVLSYR
FLKPGNISYFMDTIAFECVPPLALIGNETATCQANGTWSSIPECRAVTCPAPTGIENGFL
NFAVRRTYHYNESVSFSCQSRYVLEGPKHSRCEKTGNWSTKPSCKEPCKIPVKKAVVLYE
GEKKRVQSDLKEGIMHGETISFYCKNKEKSCAYTVPVQCVNGNLTLPFCFKERGFFSSLV
KTDPSDMKPCEDLK
Download sequence
Identical sequences A0A1D5PNU2
ENSGALP00000006298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]