SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006338 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006338
Domain Number 1 Region: 18-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-46
Family Hypothetical protein AT3g04780/F7O18 27 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006338   Gene: ENSGALG00000003986   Transcript: ENSGALT00000006348
Sequence length 209
Comment pep:known_by_projection chromosome:Galgal4:23:5536714:5538343:1 gene:ENSGALG00000003986 transcript:ENSGALT00000006348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGMAQGHGPGRCRCCGADGGERGAAWGLHLRIDRGRLQCLNERREGSGARVFRAWEERG
DREQFVESDEDAELLFNVPFTGSVKLKAVIVMGEDDGSHPSELRLFKNIPQMSFDDAARE
PEQTFNLNPDPVGELEYPTKIARFSNVHDLSMYFPKNFGAETTKIFYIGLKGEWTEAHRH
KVTICNYEASPNPADHQLQQVTPQSHCIS
Download sequence
Identical sequences 9031.ENSGALP00000006338 ENSGALP00000006338 ENSGALP00000006338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]