SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006403 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006403
Domain Number 1 Region: 603-829
Classification Level Classification E-value
Superfamily vWA-like 7.15e-59
Family Integrin A (or I) domain 0.00018
Further Details:      
 
Domain Number 2 Region: 10-216
Classification Level Classification E-value
Superfamily vWA-like 6.26e-58
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 520-642
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000212
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 411-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000152
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 838-878
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000000183
Family Chicken cartilage matrix protein 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006403   Gene: ENSGALG00000004028   Transcript: ENSGALT00000006413
Sequence length 879
Comment pep:known_by_projection chromosome:Galgal4:20:5499775:5512785:1 gene:ENSGALG00000004028 transcript:ENSGALT00000006413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMKLLPLAALLLLVLTALEARPKPAALKCRTGPLDIVFVIDSSRSVRPFEFETMRRFMID
IIGNLDVGPNATRVGVIQYSSQVQNIFSLKTFFTRAEMERAINSIVPLAQGTMTGLAIQY
AMNVAFTVQEGARPPHKKIPRIAIIVTDGRPQDRVSEVAAHARNAGIEIYAVGIQRADMN
SLRAMASPPLEEHVFLVESFELIQQFGKQFQDKLCGGLIQQLSPGTPFLGWSGTKSFRSI
AGTLLSSPVPGSSAASQDIMATGRNVELISPGIWDSFSGVPFLHSPPACFLCTSVVNETL
FSCHCSAALGWEQGGCLCHGLCYGCALQHHVFAGSTLPIASWPQCPCPSQIGRLLLTGTC
RYSCLGFFTLMNSMFQLQLSTHIEHQFSAQVDLKAEAIQNPVQTVEVPVSVCWRVDMCME
RDHGCQHSCVSTPGSFYCECHPGYQLNVDGKTCSPLPLVVACVLEGRAGRGPVRPAAAVC
SGCREGRVVSAALRDFSFPASRGAPRQKGDSVCFPAAIDACADGRHGCEHHCISARGTYS
CRCRAGYYLNQDRRSCTMIDYCSFGNHSCQHDCVSIPAGHRCRCRDGFMLQHDGKSCRAI
DLCNGVDHGCEFKCVSSEGSFHCVCPEGQQLQADGKTCSKCGAGHVDLVMVIDGSKSVRP
QNFELVKQFVNRIVDLLEVSPDGTHVGLVQYSSRVRTEFPLNKYHSAEEIKAAVMKMEYM
EKGTMTGLALKHMVEHSFSELEGARPLSHNVPRIGLVFTDGRSQDDISEWAQRAKESGIV
MFAVGVGKAVEEELRAIASEPVEQHFSYSADFTTMTHLVENFKLNICPEEGRGETEIRSP
CECEALVQFQTNTVAILQSLTHPLAQMTARLEALEKQIA
Download sequence
Identical sequences ENSGALP00000006403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]