SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006411 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006411
Domain Number 1 Region: 47-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000128
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 2 Region: 845-903
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000732
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 613-681
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 737-790
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000115
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 5 Region: 789-850
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000327
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 683-733
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000719
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 7 Region: 560-618
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000017
Family TSP-1 type 1 repeat 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006411   Gene: ENSGALG00000004032   Transcript: ENSGALT00000006421
Sequence length 947
Comment pep:known chromosome:Galgal4:8:6070282:6084211:1 gene:ENSGALG00000004032 transcript:ENSGALT00000006421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRAGWQLGLWAAALEIGRRVPQLTVLCFCQDSSEAAGGDGPWDEEVTTWWGEWSSWSTCS
RSCGGGVMSRERHCLRQRLQMPQGTNSTMCVGQAKHYQLCQQQPCPANTASFKQQQCSSF
NAKAFGKRYYHWMPLYPDDYTSISNKPCDLQCTTRNGERQLMARAQDGTSCKDRTYQGVC
INGKCEPVGCDGSLYSARTMDRCRVCGGDGSTCHRVSGSFRKAVSQIGYVFITSIPAGAM
DILIMERRKTENILEALADEYGHFFFNGNSAIDNPQNFRVAGTVFKYRRPSSLNSDGLEY
IIAHGPTNQSLNAMYYNFNGKMPHITYDYTVPRAPPPLRTAAPAVDRPRYHHPVEAGQSH
PVPANFRAAKDSNATWLSLSPDDTNQRFPLKDRHEDLGFSHPHFFHTNSTSHPRGWGWEQ
GEEKENDFHLRQVYHANEEEEEAAAVGGETEGWRLSECSWLLLVGRGANLRSVWESQTGL
SFSATPGPRASHMRLLRISISTAVPYSMRRSELLEHSRLASSRLRDPFNHLTSLFPASSS
LRSNEFDVSPVGHDDISLADMYRWKVSAYAPCSSTCTSGISASYAMCVRYDGVEVDEAYC
DALTRPEPTHEFCTGRDCQPRWETSRWSECSRTCGEGYQYRTVRCWKMLAPGFDSSVYDD
LCESAGLARPIERKACKNKACGPQWELSEWSECSARCGTQGTMKREVRCSVEAALCDESQ
KPSSEKDCTGPPCDRRWTASDWGPCSGSCGEGRISRFVACRNLEGKVISDTQCDPAAKPL
AVHPCGDKDCPAHWVEQEWDQCDASCGRGTKTRVVLCAGLENGVYREYPEKRCEAGQKPE
EQAACFMRPCSTWFTTSWSQCSKTCGAGVRLREVKCYQGEALAQGCDPASKPEGRQTCQL
QPCPTEAPEEDCEDKATANCVLVLKVKLCSHWYYRKACCRSCRLKSP
Download sequence
Identical sequences ENSGALP00000006411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]