SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006464 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006464
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-34
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 2 Region: 174-298
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-19
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 296-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006464   Gene: ENSGALG00000004071   Transcript: ENSGALT00000006474
Sequence length 525
Comment pep:known_by_projection chromosome:Galgal4:11:7152634:7168824:1 gene:ENSGALG00000004071 transcript:ENSGALT00000006474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMHYEICTFKKMLLVTILVVEGIAVAQKTQGGQNIGLNRIPPTQCDNWVRTSNGGHFASP
NYPNTYPPNQECIYILEAAPRQRIELTFDEPYYIEPSFECRFDHLEVRDGPFGFSPLIDR
YCGLKSPALIRSTGRFMWIKFTSDEELEGKGFQAKYSFIPDPDFTYLGGILNPIPDCQFE
LSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPNAKIYLRFLDYQMEHSNECKRNFVA
VYDGSSSIENLKAKFCSTVANDVMLQTGTGVVRMWADEGSRLSRFRMLFTSFVDPPCSGN
TYFCHSNMCINNSLVCNGIQNCAYPWDENHCREKKKSGLFEQITRTHGTIIGITSGIVLV
LLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELE
NYQKMRRSSTASRCIHDHHCGSQASNIKQSRTNLSSMELPFHNDFAQPQPMKTFNSTFKK
SSYTFKQAHDCPEQVIEDRVMEEIPCEIYVRGREDTAQGSLSIDF
Download sequence
Identical sequences ENSGALP00000006464 ENSGALP00000006464 9031.ENSGALP00000006464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]