SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006491 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006491
Domain Number 1 Region: 864-920
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 924-975
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 745-801
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 687-744
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000379
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 5 Region: 52-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 6 Region: 805-858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000405
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 7 Region: 635-684
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000628
Family TSP-1 type 1 repeat 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006491   Gene: ENSGALG00000004087   Transcript: ENSGALT00000006501
Sequence length 1026
Comment pep:known_by_projection chromosome:Galgal4:10:5850094:6086027:1 gene:ENSGALG00000004087 transcript:ENSGALT00000006501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDSLIVSLRLLSSLAVLGFQFVIPQPSIEHRKVPQRIEEQRDASEDSGAGIPGMWGSWG
PWSACSRSCSGGVMEQTRPCLPAYYRERGYQRPGRQYAASERTLAHQNSRHQDSLTAYPG
HIISAIRTSVPLHRNEEQLRAGLRASAPSEGHNNSHMSRGAPRGSRHSQSQRHHPKPEKR
SRNRNPIGPGKYGYGKVPYILPLQTDTGQQPQKLRRQRQSSRNNVFHQSPSLMNAYSQPA
SASLQHGNLYQEESGPQAGHQVLGPSVYQSPSFPASQNLFHSSDSTLHGSASHPMVQGQP
QPQRSAAIVCVGTYKQYKLCNTNMCPESSRSIREVQCASYNNKPFMGRFYEWEPFAEVKG
SQKCELNCRAIGYRFYVRQAEKVIDGTPCDQNGTSICVAGQCKSIGCDDYLGSDKVIDKC
GICGGDNTACKVVSGVFKHTLTNLGYHKIVEIPEGATKINITEMSKSNNYLALRSRSGRS
IINGNWAIDRPGRYEGGGTMFTYKRPNEISSTAGESFLADGPTNEVLDVYMIHQQPNPGI
HYEYIIPGDNVISPQLLAHRRPGEPLNGQLEMPESTNHNEDDLHRETDTLTGQSVGTFPV
IPPGRFPSHQPENQVPAVQLSRQNREYNWKQIGKTECTTTCGKGSQYPVFHCVNRVTHEE
VPENYCDSSTKPIPEEEACNIFPCPAFWDIGEWSECSKTCGLGMQHRQILCRQIYANRTL
TVQQYRCHHLEKPETTSTCQLKICSEWQIRTEWTSCSVPCGVGQRTRDVKCVSNLGDVVD
DEECNMKLRPNDIENCDMGPCAKSWFLTEWSDRCSAECGDGIRTRSVVCMTNHVSSLPLE
GCGNNRPSETTPCNNGPCAGKVEWFAGSWSQCSTECGGGTQQREVICVRKTEGNFDVLNP
YECSYVERPPSQQSCYLKPCGSKWFHTEWSTCSKSCEGGFRVREVRCLSDDMTTSTHCDP
QLKPEEKEPCNTQDCIPEIDENCKDKYYNCNVVVQARLCVYTYYKTACCASCTRVANRQS
GLLGHR
Download sequence
Identical sequences ENSGALP00000006491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]