SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006799 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006799
Domain Number 1 Region: 117-365
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-69
Family Nuclear receptor ligand-binding domain 0.00000000339
Further Details:      
 
Domain Number 2 Region: 48-131
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006799   Gene: ENSGALG00000004285   Transcript: ENSGALT00000006810
Sequence length 455
Comment pep:known chromosome:Galgal4:20:5763173:5777781:-1 gene:ENSGALG00000004285 transcript:ENSGALT00000006810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMADYSAALDPAYTTLEFENMQVLAMGSDTSPSEAANLNTSNSIGVSALCAICGDRATG
KHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCVVDKDKRNQCRYCRLKKCFRAGMKKEA
VQNERDRISTRRSSYEDSSLPSINVLLQAEVLAQQISSPVLVMNGDIRGKKIANIADVCE
SMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGVAKRSMVFKDVLLLGNDH
IVPRNCPELVEVSRVAIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPSKIK
RMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPVLQSITWQMIEQIQFVKLFGMAKIDNL
LQEMLLGGSSSETPHAHHPLHPHLIQENLGTNVIVANTMPPQMHNGQMSTPETPQPSPPA
GSGPEQYKLLPGAIATVAKQPTSIPQPAITKQEVI
Download sequence
Identical sequences F1NZ15
ENSGALP00000006799 9031.ENSGALP00000006799 ENSGALP00000006799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]