SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006818 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006818
Domain Number 1 Region: 557-801
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.02e-78
Family Eukaryotic proteases 0.000000369
Further Details:      
 
Domain Number 2 Region: 369-462
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-38
Family Kringle modules 0.0000347
Further Details:      
 
Domain Number 3 Region: 90-183
Classification Level Classification E-value
Superfamily Kringle-like 3.56e-35
Family Kringle modules 0.0000435
Further Details:      
 
Domain Number 4 Region: 272-359
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-35
Family Kringle modules 0.0000309
Further Details:      
 
Domain Number 5 Region: 184-267
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-35
Family Kringle modules 0.0000209
Further Details:      
 
Domain Number 6 Region: 468-555
Classification Level Classification E-value
Superfamily Kringle-like 8.17e-34
Family Kringle modules 0.0000658
Further Details:      
 
Domain Number 7 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.24e-19
Family Hairpin loop containing domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006818   Gene: ENSGALG00000004293   Transcript: ENSGALT00000006829
Sequence length 802
Comment pep:known chromosome:Galgal4:3:44679918:44701209:1 gene:ENSGALG00000004293 transcript:ENSGALT00000006829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISKATLLLLFLLSSVQGSILDNYVRTEGAWLLNSKKETYKTSSKEECAEQCETETKFP
CRAFLFTSKDQQCITLAENTKTAVLFRRTNAVLYEKRIYLLECKKGRGKDYRGTEAKTQK
GVACQKWADTAPHKPNYTPEKHPSAGLEENYCRNPDNDEKGPWCYTTDPNTRFDYCNIPE
CEVECMHCSGENYHGVVATTASGLECQRWDSQLPHSHGYLPENFPEKDLKMNYCRNPDGE
PRPWCFTTNPNKRWEFCDIPRCTTPPPVPAPGRQCLSGRGEDYRGKISVTESGNTCQHWS
AQFPHKHARTPENYPCKNLEENYCRNPDGEQMPWCYTTNATARWEYCTIPSCDGKEPDTP
AVDQPEQAQATEECYQGNGVSYRGTASFTITGKKCQAWNSMSPHRHNKTSEHFPNADLRQ
NYCRNPDADSRPWCYTTDPSVRWEYCNLKRCSDNIQTILPKPPQTTLEPNPDCIHSNGID
YRGTVARTARGRICQEWSSQTPHKHDYFTPRTHPKSGLEKNYCRNPDGDVNGPWCYTTDP
RKAWEYCDIPKCSPAQYECGKAKVRPKLCAQRIVAGCISHPHSWPWQISLRTSYGLHFCG
GTLIDPKWVLTAAHCLEKSLRPSSYKVYLGLHEERALESSVQKRDVEKLFKEPHGQDIAL
LKLRSPAVITDQVIPVCLPKENAVLGGREECYVTGWGDTKGTPGQGYLKETGFPVIENKI
CNRPEFLNGRVKKHELCAGNIHGGTDTCQGDSGGPLVCLDQDKFVQHGVTSWGLGCALPM
KPGVYVRVSAYIPWIKSIMENN
Download sequence
Identical sequences F1NWX6
XP_419618.2.86415 ENSGALP00000006818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]