SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000006909 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000006909
Domain Number 1 Region: 1167-1338
Classification Level Classification E-value
Superfamily C-type lectin-like 1.57e-72
Family Endostatin 0.00000022
Further Details:      
 
Domain Number 2 Region: 46-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-32
Family Laminin G-like module 0.0077
Further Details:      
 
Domain Number 3 Region: 780-862
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000235
Family Endostatin 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000006909   Gene: ENSGALG00000004338   Transcript: ENSGALT00000006920
Sequence length 1344
Comment pep:known chromosome:Galgal4:7:6650612:6681644:1 gene:ENSGALG00000004338 transcript:ENSGALT00000006920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGCAPRRLLLLGLFVLLLLPAASQEPENLSTEVSLLELIGDPPPEEILKIYGPDNNPG
YVFGPSANTGQVARYHLPSPFYRDFSLLFHIQPTTPRAGMLFAITDSTQSIIYVGVKLSD
LQMGKQQIIFYYTEPGSQSSYAAATFTVPTLLNQWTRFAISVEEDEVILYLDCEEHERVR
FERSPDEMELEEGSGLFVAQAGGADPDKYQGVIADLRLRGDPRAAEHQCEEEEDDAEASG
DFGSGAEDRHHPSGKDKGIPGLLDAVPVTSPPVVEGSGTRSSAGSPQQAERTRVEERLQV
STGGTGPKGEKGEKGERGPKGDSGTSGILGTGATKGEKGEKGELGIKGSAGFGYPGSKGQ
KGEPGEPGPPGPLSRHTDSMSLEQVTGPPGPTGPPGKDGAPGRDGEPGDPGEDGKPGEMG
PQGFPGTPGESGQKGEKGDPGVGPRGPPGPPGPPGPPGRSSKQDGLTFIDMEGSGFGGDL
ETLRGPRGPPGPPGPPGVPGLPGEPGRFGMNSTDLPGPPGLPGRDGTPGAPGPEGPLGPP
GKDGMPGPPGPKGERGDVGDLGLPGAPGPKGSKGEAGPAGPPGETGLAGLPGPVGPRGPP
GPPGPPGPPGPGYEAGFGDMEGSGLPLATGSPGPRGPSGPQGVPGLPGIKGEVGSLGQPG
PPGPKGDAGVPGVDGRPGLEGFPGPQGPKGNRGSPGEKGERGQDGVGLPGPPGPPGPPGQ
VIYMSSEDRPLVALPGPEGRSGHAGFPGPVGPKGDPGSPGIQGAPGMKGEKGEPGVIISP
DGTIVAANVKGQKGEPGLPGPMGPSGPHGRAGMKGEIGFPGRPGRPGMNGLKGEKGDPVD
ISSVLSLRGPPGPPGPPGPPGPPGSVVYDSNNGFSDASRPAFPGFHQFPGQKGEKGDVGA
PGPPGQFPYDLSRFSASLRGDKGEAGPKGEKGEPGSSTLYGPSVTGPPGPQGYPGPPGPK
GDSIVGPPGPPGPQGPPGIGYEGRQGPPGPPGPPGPPSFPGPHRQAISIPGPPGPPGPPG
PPGTSGTSLGLRTMPTYQAMLSAAHELPEGGLIFLADRQELYIRLRGGFRRVLLEEHTLV
PSSALDNEVYDKLPSIHYGGAQQPVHPLRNHNTPPTARPWRGDEVVANQHHLPQPPLLQQ
HELLNSYYIHRWPDPAPVAAHVHQDFQPALHLVALNTPLSGGMRGIRGADFQCFQQARQV
GLAGTFRAFLSSRLQDLYSIVRRADRTAVPIVNLRDEVLFSNWEALFTGSEAPLRAGARI
LSFDGRDILQDSAWPQKSIWHGSDAKGRRLPESYCEAWRTDERGTSGQASSLSSGKLLEQ
SASSCQHAFVVLCIENSFMTAAKK
Download sequence
Identical sequences ENSGALP00000006909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]