SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007090 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007090
Domain Number 1 Region: 76-342
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.27e-86
Family Eukaryotic proteases 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007090   Gene: ENSGALG00000004463   Transcript: ENSGALT00000007102
Sequence length 579
Comment pep:known_by_projection chromosome:Galgal4:9:15070176:15075593:1 gene:ENSGALG00000004463 transcript:ENSGALT00000007102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPMVCLSCPVMLLLLQLAGGAPIGQGLYPMPASVLQALSSRGTLVLEAALRSALMALEQA
LAEQQKQRGSCRPAGCPRPTARSLPFIPPERCGSREDPPPNSTAPRGRIMGGNVARHGAW
PWLVSVRLHGELVCGGVLVSRAWALTAAHCFNGNQNELAWTVVVGDHELGKADPGERAVP
VRRIVPHPKFNPKTFHGDLALLELAEPLAPSGTVSPVCLPSGTTEPSPGTPCHIAGWGSL
YEEGPSAEVVMEAQVPLLSQETCRAALGRELLTSTMFCAGYLSGGIDSCQGDSGGPLVCQ
DPSSHSFVLYGITSWGDGCGERGKPGVYTRVAAFADWLSLQMNPVPGSREPSCFDLLALS
QLAPEQQPLERTRLCSFYERSCRAAPGQASCTHIADETCRARLRRCEPTELHSYTQTLVG
LLRRADPAMAEHPTSEGPLRPPHRQLPTFREFFGSVGPRLQDWVQALRATAGGSAQAPTP
DVPPAAACPGLNASALRVGVVQELYAWVLQVPQPDLAMTFQEILVDLSSKNTKGLYRAQV
RATVGGRPTAFTGLVGLESDSLARSMPGLVALALEALKT
Download sequence
Identical sequences ENSGALP00000007090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]