SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007125 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007125
Domain Number 1 Region: 126-266
Classification Level Classification E-value
Superfamily TNF-like 1.74e-39
Family TNF-like 0.000000112
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000007125
Domain Number - Region: 59-112
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0314
Family beta-sandwich domain of Sec23/24 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007125   Gene: ENSGALG00000004481   Transcript: ENSGALT00000007137
Sequence length 269
Comment pep:known_by_projection chromosome:Galgal4:4:1099070:1170405:1 gene:ENSGALG00000004481 transcript:ENSGALT00000007137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTGLRDSALALLNFFHPEEKLHVGEGRRVRRNKRSKGSEGPDGPSSVKNKKKGKKAGPP
GPNGPQGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGATDKAG
SRDTQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHARSGELEVLVDGTYF
IYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNFNTCYTAGVCLLKARQKIAV
KMVHADISINMSKHTTFFGAIRLGDAPAS
Download sequence
Identical sequences ENSGALP00000007125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]