SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007126 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007126
Domain Number 1 Region: 239-441
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.99e-48
Family Reprolysin-like 0.0022
Further Details:      
 
Domain Number 2 Region: 535-585
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000746
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 954-1003
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 830-889
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number 5 Region: 893-951
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000262
Family TSP-1 type 1 repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007126   Gene: ENSGALG00000004553   Transcript: ENSGALT00000007138
Sequence length 1150
Comment pep:known chromosome:Galgal4:6:11114347:11163106:1 gene:ENSGALG00000004553 transcript:ENSGALT00000007138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYLRLVLSCLVPLHGCLAAGGPELLLSGQLSEYGVTVPFSADCRGRFLSHILSGGTATT
APTEAPCPPAPARRRRGAHHASSQHGAGSRPIYFNVTVLGRELHLRLRPNTGLVPPRAVA
EWQEDFGLRLRQPLQHHCLFTGDITGVPGGAVAISNCDGLAGLIRTDSGEFFIEPLERGQ
QDTEARGRAHVVYPRTAVQRGPPQPPGVQLGELPNSLERLAERLGEAERRRRHARRDGYN
IEVLLAVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESLGVHINIVLVRMIMVGYRQSV
SLIERGNPSRSLEQVCRWAHAQQRSDPDHAEHHDHAVFLTRQDFGPAGMQGYAPVTGMCH
PLRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCADETSMGSIMAPLVQAAFHRYH
WSRCSKQELNRYIHSYDCLLDDPFEHRWPSLPELPGINYSMDEQCRFDFGVGYKTCTAFR
TFDPCKQLWCSHPDNPYFCKTKKGPPLDGTECSLGKWCFKGHCIWKTSEQPYSQDGSWSS
WSKFGSCSRTCGGGVRSRSRSCSNPPPAYGGRNCPGATYEHQVCNSEECPGPYEDFRAQQ
CSKRDSYYTHRDSKHAWLPYEHPDDAQKCELICQSEGTGDVVFMNQVVHDGTRCSYRDPY
SICVRGECVHVGCDKEVGSLKQEDKCGVCGGDNSHCRTVKGTLAKTPKQPGSVLKMFEIP
AGARHVQIEEMEPASHSIAVKNQATGNFILNAKGQETTSKTFIEMGLEWEYTVEQGKESL
KTSGPLHEAISVLLVAREEAVRSSLMYRYIIHEDLLPLIGNNNVLLEEMDSYEWALKSWS
QCSKACGGGIQYTKYGCRRRSDNRMVHRNLCDNGKKPKPIRRRCNLQECSQPTWVAEEWS
ACSKSCGKLGLQVRAVQCVQRLRDGTNRTLHAKYCSAERPETRRPCSRLPCPAQWRTGAW
SQCSASCGDGVQQRQVVCRGEESGGRCHGDKPEAIRGCHVAVCLGKPSGITASANASDHV
TPGGQWETRERPQNPVSKISSREPCLGDKSIFCQMEVLARYCSIPGYNKLCCESCGKKAS
VTASPTDIPTGTPVGTPSPTAPSSSVQGTPGTNPTTATPREVPAPRCHQSLQGDPPDVLG
ESDELRECPL
Download sequence
Identical sequences ENSGALP00000007126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]