SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007258 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007258
Domain Number 1 Region: 11-269
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.25e-83
Family Eukaryotic proteases 0.000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007258   Gene: ENSGALG00000004568   Transcript: ENSGALT00000007270
Sequence length 270
Comment pep:known chromosome:Galgal4:21:5542650:5547423:1 gene:ENSGALG00000004568 transcript:ENSGALT00000007270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGILFAVLTLAAAALGCGVPAYPPAVSRVVGGEDARPYSWPWQASLQYQSSGKWYHTCG
GTLIATNWVLTAAHCISSTRKYRVLLGKYNLEAEEQGSVTASTEKIIVHEKWNRFSVASG
YDIALIKLTEHVELSDKIKLACLPPAESILSSNTACYVTGWGRLQTNGALPDELQQGLLL
VVDYATCSKTNWWGSTVKTNMVCAGGDGITSSCNGDSGGPLNCQNADGAWEVHGIVSFGS
SLGCNYYQKPSVFTRVSAFDSWIKKVIENN
Download sequence
Identical sequences E1BQL7
ENSGALP00000007258 ENSGALP00000007258 NP_001027562.2.86415 9031.ENSGALP00000007258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]