SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007361 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGALP00000007361
Domain Number - Region: 21-90
Classification Level Classification E-value
Superfamily CalX-like 0.0981
Family CalX-beta domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007361   Gene: ENSGALG00000004628   Transcript: ENSGALT00000007373
Sequence length 366
Comment pep:known_by_projection chromosome:Galgal4:19:6644177:6651313:-1 gene:ENSGALG00000004628 transcript:ENSGALT00000007373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMRHLCPPVLLLTLVLLVHCDGVIVLSVPEVVLLENGSSTNVTISLRAPLNDTLVITLNI
THSSKHSTIVELPDEIQLPAGHTKAGFQVKADDVGQVTVYLYTSNSNLTGPRIQFQVIHS
IIVKYVDEVIGWIYFLAWSISFYPQLFENWRRKSVVGLSFDFIALNLTGFIAYSVFNVGL
FWIPLIKEEFLLHYPNGVNPVAINDVFFSLHAVALTLLTIIQCCIYERAGQKVSKTVVGL
LALAWIFTFTTLFLAAAEEMTWLQFLFCFSYIKLAVTLIKYFPQAYMNFRRKSTVGWSIG
NVLLDFIGGSFSLLQMFLQSYNNDEWKLIFGDPTKFGLGVFSIIFDIVFMVQHYCLYRRR
GYEPCE
Download sequence
Identical sequences ENSGALP00000007361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]