SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007389 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007389
Domain Number 1 Region: 80-263
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-75
Family F-box associated region, FBA 0.00000244
Further Details:      
 
Domain Number 2 Region: 17-96
Classification Level Classification E-value
Superfamily F-box domain 6.76e-18
Family F-box domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007389   Gene: ENSGALG00000004646   Transcript: ENSGALT00000007401
Sequence length 274
Comment pep:novel chromosome:Galgal4:21:5662767:5666543:-1 gene:ENSGALG00000004646 transcript:ENSGALT00000007401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRVPSVCYRFCRAMATISDLPEDVLVELLSLLPARDLLRACRPVCSQWRDVVDLTTLWK
RKCQREGFYVQSLDRSITDWKVFYLLCKLKRNLIKNPRAEESFKHWKLDQNEGDKWKIED
LPGPLGKELPDSEVRKYFVTSFGPCFKSQLITLKKEGYWNELMDEKRPEIVVKDWYAARF
DCGCRYELRVRLLSENYIVLDEFCPEPVVIEQWSDAMWREISHTFSNYPAGVRYIWFQHG
GQDTQFWAGWYGIRVTNSSITIGPQTLKANEDTI
Download sequence
Identical sequences ENSGALP00000007389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]