SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007409 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007409
Domain Number 1 Region: 63-247
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.76e-77
Family F-box associated region, FBA 0.0000000779
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000288
Family F-box domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007409   Gene: ENSGALG00000004657   Transcript: ENSGALT00000007421
Sequence length 247
Comment pep:known_by_projection chromosome:Galgal4:21:5667616:5670436:1 gene:ENSGALG00000004657 transcript:ENSGALT00000007421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLPEAVLIRILASIPAVDLVLACRLVCCQWKNLVDGAALWILKCQQEGFAGAESEENA
ENWQNFYFLSKRRRNLIKNPCGEEDLQHWGEVENGGDGWKIEELPGDFGKEFPSEEVHKY
FVTSYEWCRKSQVIDLRAEGYWEELMDTTQPKVVVKDWYAGRSDAGCLYELCVKLLSENE
DVLAEYKTETIAIPQDNDASWTEISYTFSDYGPGVRFVRFEHGGQDTLFWKGWYGVRVTN
SSVTVEP
Download sequence
Identical sequences A0A1D5PMY0
ENSGALP00000007409 XP_015152700.1.86415 XP_015152701.1.86415 XP_015152702.1.86415 XP_015152703.1.86415 XP_417650.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]