SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007857 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007857
Domain Number 1 Region: 2159-2309
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.99e-32
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00075
Further Details:      
 
Domain Number 2 Region: 2625-2682
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000301
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 3 Region: 2899-2955
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000327
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 4 Region: 3057-3108
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000235
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 4802-4858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000262
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 6 Region: 2788-2839
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000288
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 7 Region: 3255-3302
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000183
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 8 Region: 3643-3692
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 9 Region: 1612-1649
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000681
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 2572-2625
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000222
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 11 Region: 3698-3749
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 12 Region: 2475-2514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 13 Region: 1257-1319
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000589
Family ATI-like 0.052
Further Details:      
 
Domain Number 14 Region: 1398-1435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 15 Region: 4694-4754
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000114
Family ATI-like 0.053
Further Details:      
 
Domain Number 16 Region: 1553-1592
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 17 Region: 1477-1514
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 803-869
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000278
Family BSTI 0.082
Further Details:      
 
Domain Number 19 Region: 4052-4107
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000419
Family TSP-1 type 1 repeat 0.00094
Further Details:      
 
Domain Number 20 Region: 4639-4694
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000549
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 21 Region: 2534-2571
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000072
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 22 Region: 1514-1548
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000102
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 23 Region: 3407-3450
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000107
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 24 Region: 1432-1474
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000012
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 1787-1835
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 26 Region: 1902-1961
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000262
Family ATI-like 0.059
Further Details:      
 
Domain Number 27 Region: 1359-1394
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 28 Region: 1698-1732
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number 29 Region: 4910-4976
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000638
Family VWC domain 0.021
Further Details:      
 
Domain Number 30 Region: 4437-4484
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000654
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 31 Region: 3010-3074
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000136
Family VWC domain 0.07
Further Details:      
 
Domain Number 32 Region: 3161-3217
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000018
Family BSTI 0.047
Further Details:      
 
Domain Number 33 Region: 4590-4640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000222
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 34 Region: 447-509
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000294
Family ATI-like 0.043
Further Details:      
 
Domain Number 35 Region: 4261-4318
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000589
Family ATI-like 0.043
Further Details:      
 
Domain Number 36 Region: 3959-4015
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000119
Family BSTI 0.031
Further Details:      
 
Domain Number 37 Region: 3115-3155
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 38 Region: 859-925
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000324
Family VWC domain 0.056
Further Details:      
 
Domain Number 39 Region: 1652-1688
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000327
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 40 Region: 2322-2359
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000497
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 41 Region: 2958-3018
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000523
Family BSTI 0.091
Further Details:      
 
Domain Number 42 Region: 1842-1884
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000536
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 43 Region: 4500-4550
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000572
Family BSTI 0.081
Further Details:      
 
Domain Number 44 Region: 2688-2748
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000665
Family ATI-like 0.035
Further Details:      
 
Domain Number 45 Region: 4151-4209
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000759
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 46 Region: 3315-3365
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000128
Family ATI-like 0.059
Further Details:      
 
Domain Number 47 Region: 953-999
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000188
Family Fibronectin type I module 0.07
Further Details:      
 
Domain Number 48 Region: 3532-3588
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000262
Family ATI-like 0.062
Further Details:      
 
Domain Number 49 Region: 2848-2900
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000275
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 50 Region: 4859-4918
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000327
Family ATI-like 0.049
Further Details:      
 
Domain Number 51 Region: 1997-2055
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000549
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000007857
Domain Number - Region: 4208-4258
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000126
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number - Region: 3753-3810
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000213
Family BSTI 0.05
Further Details:      
 
Domain Number - Region: 1746-1774
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000249
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number - Region: 2748-2804
Classification Level Classification E-value
Superfamily FnI-like domain 0.000345
Family VWC domain 0.028
Further Details:      
 
Domain Number - Region: 3845-3876
Classification Level Classification E-value
Superfamily FnI-like domain 0.000963
Family Fibronectin type I module 0.048
Further Details:      
 
Domain Number - Region: 3490-3523
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00314
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number - Region: 4364-4428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00916
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number - Region: 2053-2118
Classification Level Classification E-value
Superfamily FnI-like domain 0.0335
Family Fibronectin type I module 0.081
Further Details:      
 
Domain Number - Region: 499-547
Classification Level Classification E-value
Superfamily FnI-like domain 0.0847
Family Fibronectin type I module 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007857   Gene: ENSGALG00000004919   Transcript: ENSGALT00000007871
Sequence length 5081
Comment pep:novel chromosome:Galgal4:2:407640:442670:1 gene:ENSGALG00000004919 transcript:ENSGALT00000007871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIVATVLLWVVTEAARGRWCERTEQVTEEEVVMPRREDVVPCPSMYQYSLAGWRIDLNR
MRQVYGGRGVPPTSTHPGAAMCYIYRPPETQLVVRNRTVRACCAGWSGLHCTEVEGSLGQ
CHASWQCQDAVGAHNLSTVSMAECCRQPWGHSWRNGSSALCFACSRQPLTGDVPLPTAPR
GPAARHRGPTASCTVWAGSRYRSFDGRHFGFQGECAYSLAASTDSTWAVSITPGSLPVLH
MTFGLDTVVARGHNISVNGVAVPEGRQHLHGGISVTWLGDFVAVESGLGVHLKLDGRGTV
YVTVSAELRGSTKGLCGPYNDDPTDDFLRVEGDVAPLAASFGNSWRIPDANPELSCSDAV
EPSPGCAMGSTAQRAAEAMCGMLLTDPFRQCHEAVDPHGFYEACLELHCREGGTGPSPPP
AVCDTLATYVRDCAQRRAYIEWRRPGLCERQCGHGQRYSDCVSSCPASCMAAGTAEEGHC
RDNCASGCECTPGLLLDRGACIPQSACPCLHRGHIYAPGQSIRQRCNQCTCRGGRWLCTQ
DRCAAECAVLGDLHYITFDRRRFSFPGACEYTLVQDFVEGTLRITVEQEACGGHQPLSCL
RALSITVPGTSARLHSTGEVVVDGRVVPLPFASAALTVRRASSSFLLLQTFGAHLLWGLE
TPAAYITLQPAFANKVRGLCGTYNWDQRDDFATPAGDVEVGVTAFANKYRVSTDCPVLSP
VPFEPCSTYAPRRELAAAACAILHGASFQPCHHLVDWEPFHQLCLYDVCACPAGKHCLCP
ALAAYARECAQEGAALSWRNESFCGTQCRGGQVYQECSSPCGRTCADLRLDGASSCPSLD
NICVSGCNCPEGLVLDDGGQCVPPGVCPCQHGSQLYPAGSKIRQGCNACICTVGTWSCTD
APCPDAALCPGDLIYVFGSCLRTCDSAEPNGTCTGIADGCVCPPGTVFLDKRCVPPEECP
CQHNGRLYQPNDTIVRDCNTCVCRQQRWQCSSEDCMGTCVATGDPHYITFDGRAFSFLGD
CEYVLVREANGLFTVTAENVPCGTSGVTCTKSVVVEMGNTVVHMLRGRDVTVNGVSVRPP
KVYSGNGLTLQRAGIFLLLLSRLGLAVLWDGGTRVYIRLQPQHRGRVVGLCGNFDRDAEN
DLASQQGVLEPTAELFGNSWRVSLLCPEVDGTTVQHPCTDNPHRATWARKRCSILTQRLF
APCHDEVPCQHFYDWCIFDACGCDSGGDCECLCTAIATYAEECSQRGIHIRWRSQDLCPM
QCDGGQEYSACPPCPQTCRNLGLELPEHCDTMSCLEGCFCPEGKVLHEGSCIDPAECPCF
WQGIAFPDSAVVQQGCRNCSCTAGLWQCVPTAEPCPAQPHCPDSEFPCRSGGRCVPGAWL
CDNEDDCGDGSDEVCALHCAPHQHRCADGQCVPWGARCDGLSDCGDGSDERGCPPPPCAP
PEFRCASGRCIPRAHVCNGELDCGFADDSDEAGCSPSCSAGEFQCAAGRCVPYPHRCNGH
DDCGDFSDERGCVCPAGHFQCPDAQCLPPAALCDGMQDCGDGTDEAFCPDRITCAPGQLP
CPDGSCVSQVKLCDGIWDCRDGWDERSVRCMVSWAPPAPTQLPTVPANGTAAPVCGPYEF
PCRSGQCVPRGWVCDSEADCPDNSDELGCNRSCVLGHFPCALGAHCIHYDHLCDGIPHCP
DHSDESDDNCGSTQIPPCPGHFVCNNRVCVNATRVCDGALDCPQGEDELACEGYVPTGER
NQTVGPCAEYSCRDGDCITFKQVCNGLPDCRDGDMASGWLPSDEWDCGQWGPWAPWGICS
HSCGLGQQLRARECSQRTPGVLHQCHGEATQARPCFSTACPVDGAWSEWTMWSNCTQGCE
GVVVRQRHCQPPQDGGRPCAALPTTAHATLEIGTCQQDGCPPASCPGGLQPRPCAPCPAS
CADLASRAPCRREQCTPGCWCAEGLVLDGERGCVRPRECRCEVDGLRYWPGQLMKLNCRL
CTCLDGQPRRCRHNPACSVSCSWSAWSPWGECLGPCGVQSIQWSFRSPSHPGKHGTNRQC
RGIYRKARRCQTEPCQECEHQGRSRAQGDRWRWGPCHVCQCLPGPEVRCSPYCARSAVGC
PQGQVLVEGKGDSCCFCAQIGDNVTAIPTALTMEPPSTMPGEPSDSPLPMFPLPSPGDPC
YSPLGIASLPDSSFTASAEQQQHPARAARLHHVSPGLELQGWAPPADTVPGLPSHLPFLQ
LDLLQTTNLTGVVVQGAGAGDAFITAFQLQFSTDGNRWHNYQQLFQGNWDATTPVVQPLG
RMVQARYVRILPQSFHNAIFLRAELLGCPTVPLDLAVTTAVTPAPCGTGEFWCGVSCVTA
SRRCDGATDCPGGADEAGCEPPSSTTLPTHPASLTTPGSAGILGLTAEPPVAPPAAVPEG
TSAWLTVGSTSPAVPSTTRLPGVPTATITPRGPPSAGPPSPGMAAVTVSHPVTGPPALPM
PPTGVPTPTSAEPPLPRLLCPPDQFLCDALGCVDAAMVCDGQQDCLDGSDEAHCGALPTS
GSSPSPLAWPSGPSPTCSPKQFSCGTGECLALEKRCDLSRDCADGSDESSCADCILSPWG
GWSQCSHSCGLGVTSRQRVLLRGALPGGTCHTPRLDTRACFLRACPVPGAWAAWGVWSSC
DAECGGGMRSRTRSCTDPPPKNGGQPCAGEALQSQPCNLQPCGDTRVCGPGMVLVQEGDC
VQGLVPPCPQVCGDLSATSSCQSPCQEGCRCPPGLFLQEGTCVNASQCHCHQGQQRWLPS
QVFLRDGCSQCVCRDGVVTCEDTACPIACAWSAWSLWTLCDRSCGVGMQERFRSPSNPAA
ANGGAPCDGDTREVRECHTPCATAEPSSGWSSWTPWSPCSQSCFHHVDQRGRRHRFRHCE
GMGTCPGLGVQEEPCDTAPCPVAGVWMPWSAWSECSAPCNAGVQTRSRTCTPPAFGGAEC
TGPHLQTRNCNTRPCGAQCPDTMQYLTAEECRHSEGRCPWICQDLGAGVACTAQCQPGCH
CPAGLLLQNGTCVPPSHCLCHHRGHLYQPGDITALDTCNNCTCVAGQMVCSTETCPVPCT
WSNWTAWSTCSHSCDVGMRRRYRVPIMPPLAGGGPPCQGPSMELEFCSLQPCRAVAPWGP
WSECSVSCGGGYRNRTRDGPPLHSLEFSTCNPAPCPGKEPGVCPPGKQWQACAQGAASCA
ELSAAPPADGSCHPGCYCPPGALLLNNECVAEAACPCAMDGVLYQPGDVVPQGCHNCSCI
AGRVTNCSQEDCGDVDGPWTPWTPWSECSASCGPGRQRRYRFCSAHPGVPCAEPQPQERP
CARQPCHPPDCAAVPGSVFSHCGPPCPRSCDDISHCVWHCQPGCYCTNGTLLDATGTACV
ALENCTCLDAHSGQRHQPGQSVPRGDGCNNCTCTQGRLLCTGLPCPVPGAWCEWSPWTPC
SRSCGDEAATRHRVCSCPAPQQGGAGCPGGLEGHGDTGMQLQHQECPSVPPCPEDGGRGL
PWGPWVGLVGAGGGQAVRTRSCSPPARFGGLPCAGEARQSRACPWATSSCPECAGGLVAF
ACGKPCPHSCEDLREDTACMATPRCLPACACPHGQLLQDGDCVPPELCRCAWAPSKNGSI
WEQDGAVPMQELQPGETVQRHCQNCTCKSGTLQCHAEPGCRADGGWSPWGPWSPCSPGCQ
AGTQLASRQCNNPTPQLGGRGCSGHSQRQRPCPATEGCPEEEPWGEWSPWGPCSASCGGG
EQLRHRDCPPPGGCPGLALQSKTCNTHVCREAGCPPGRLYRECQQGEGCPYSCAHLAGRI
ACFPGGCQEGCHCPTGTLLHHGHCLQECPCVLTAEVLRELRNSSADLQAPPLLLGTRGPP
LALDQELPPGSTIHSACTSCTCLHGRLNCSEPVCPRDGXGSGSGSGSGSGSGGGEWEWEW
EWDGMGVGMEQGWEQRMGMEVGMGMEMGTEMQTGMGMGMGLEWYLRAGAADKCPLPGDSC
PPGMALVTCANHCPRHCGDLQEGIVCREEEHCEPGCRCPNSTLEQDGGCVPLAHCECTDA
QGHGWVPGSTHHDGCNNCTCLEGRLRCTDRLCPPLRCPWSRWSRWSPCSVTCGDGQQTRF
RTPTAGSWDEECQGEQMENRGCAAGPCPPLCPQGSWERRLGDTWLQGECQRCTCTPEGTV
CEDTTCAGAEHCTWGTWSPCSRSCGTGLASREGSCPCPFPGPPGALCNASTGDGARAHRE
VQACYLRPCPAECSWSAWSSWGGCSCSSPLQHRYRHRHGTGLCVGLDVELHPCNTSGCSE
SSCEPPFEFQPCSPPCARLCSTLQHPELCPAQSHCLPGCFCPQGLLEQRSACVPPEQCDC
LHTNESGDLVTLSPGDIILLGCKECVCQDGALQCSSEGCQGLLPLSPWSEWTPCSTCLPL
FPSHLGDVTPHVSVQHRYRACLDPQSGQPWSGDTAVCSAELQQQRLCPDPDICQELCLWS
PWGPWGPCQQPCSGSFRLRHRHLQRLAGSGQCQGAQTQSESCNTAVCPGEDCEKQGRVFA
TTCANSCPRACADLWQHVECVQGGCKPGCRCPQGQLLQDGLCVPTAQCRCGLSGDNGTQE
LWPGQEATIECHNCTCENGTMVCPALPCPSYGPWSTWSPCSSSCGSGRTSRHRTCEPNPG
GVPCMASGMQETAECSPQPCPAGCQLSPWSPWSPCSSSCGGGRSERSRELLGGEEEPCPI
PALRQHRVCNVHNCTQECPRSQVHRECANACPHACADLRPQTQCLPQPCQPGCACPPGQV
LQDGACVPPEECRCTLDSTMPGVLNLSREEQEQEHAPGSRLQHRCNTCVCIRGTFNCSQE
ECNVDCLWSPWSPWSPCSVTCGMGERLSHRHPLRQRLYEGAECLGPPVRRAACHLPDCAC
PEGERWQGPEVPPGCEQSCRDILDETPANCTPSPSPGCTCEPGHYRNSSGHCVPSTLCEC
LHQGQLHQPGSEWQEQCARCRCVDGKANCTDGCTPLSCPEGEVKVREPGRCCPVCRMEWP
EEPSSMCRRFTELRNITKGPCSLPNVEVSFCSGRCPSRTAVTPEEPYLQTLCECCSYRLD
PGSPVRILSLPCAGGAAEPVVLPIIHSCECSSCQGGDFSKR
Download sequence
Identical sequences ENSGALP00000007857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]