SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007904 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007904
Domain Number 1 Region: 1463-1531
Classification Level Classification E-value
Superfamily C-type lectin-like 1.18e-24
Family Noncollagenous (NC1) domain of collagen IV 0.0000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007904   Gene: ENSGALG00000004946   Transcript: ENSGALT00000007918
Sequence length 1531
Comment pep:known_by_projection chromosome:Galgal4:9:8788722:8851270:-1 gene:ENSGALG00000004946 transcript:ENSGALT00000007918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWDRKVTEERCSYNLVINLFVEVWLLIVFSAQEIDGGGYAYIDPCGGQDCSVCRCFPEKG
SRGQPGELGAQGPIGSLGPTGPAGLPGEKGQRGENGQPGPAGEKGDKGPTGVPGFPGLDG
VPGLPGSEGPRGKHGVDGCNGSRGDPGFPGENGYIGPRGPYGNPGQKGEKGNSVYVSYYG
KGPPGDRGDPGPPGMPGPRGSAGTTGPPGYPGQPGMPGIPGYPGLPGEQGNPGIGVDGQK
GEPGDVGLPGPPGSPLLVGPPGAQLFKGEKGQKGLPGITGYRGPHGPKGIPGKGEKGEKG
IPGFPGLRGSPGSHGPAGFPGIKGEMGVAGFPGKPGYPGIKGDPGEKGLPGPPGTPLLPM
KGPPGDPGFPGPAGDMGSVGPSGPVGMLGRPGDDGTSLPGLPGISGAPGPQGFQGDPGLP
GTGEAIPGRPGFPGPPGLPGQPGRQGLPGLPSVICTERGIPGEPGAKGQIGLPGRKGEKG
EKGNQGLCSCSAGPPGPRGIQGPSGTQGKKGQMGYPGRRGEKGDSGLSGAVGSPGLPGTP
GSGGQHGEKGEKGDQGRVSIKGIKGERGPTGVPGFPGQKGNDGRDGDLGLPGEKGDEGDS
GVPIPGDKGFPGVPGLPGVKGPMGLPGLGFPGPPGVRGTPGDFGDDGNIGLPGPKGQKGD
TICITSPYPGNPGPPGFKGVQGPKGLKGLPGLPGRSGFDGPKGQQGRPGAGIPGPEGFRG
TAGDPGDEGERGSTIDGKNGAPGPPGIDGQKGVSGDTTYGPPGFPGNRGLPGPPGAQGAR
GDPGIPGLQGHPGTPGFPGAKGFRGPEGDTGAPGCPGTPGPPCDTQLPGPPGLRGVIGLP
GSQGLPGFKGQKGDRGLAGPPGIKGLKGSPGSQGPPGPPGSRGLPGLPGNKGQPGFPGQT
GSKGIQGPQGFPGLPGTQGQMGIPGVKGEEGNMGPPGPSGECGDMGMKGLFKGERGLPGG
GGSINIRLEKGQKGEPGFPGENGFRGERGEKGNTGFRGAPGFPGNNGAPGLPGDHGDIGL
MGFPGSRGFPGPKGSKGVTGFKGLPGDQGDVGSPGMPGNPGLTGPKGPKGKRGDPTLLLG
TQGQKGPPGDLGLPGFCGFPGEKGSPGIRGQPGRPGSKGEPGYPGIPGFPGATGPPGLPG
EPGEKGKHGILGPPGLLGLTGSPGRKGLPGLPGLDGLDGLKGQKGSAGAPGQSETGRPGY
SGEPGPKGERGEPGWPGISIPGTPGERGFPGFPGRRGPVGPIGPRGPSPSSAPPGLPGDQ
GPPGLDGIRGQPGNPGPPGETVFVRGDPGDTGIRGAPGIPGHRGLQGARGLPGNQGREGP
KGPMGIHGLQGPPGAVGQPGDQGFQGKPGPKGPTGTLHATGEPGEPGKTDDSCPAIPGPP
GEAGHRGDDGSIGLPGPIGHPGPQGRKGEEGSCGLPGQDGLPGAPGPPGDQGHVGEQGYA
GPQGPPGQTGIPGPPGPHVRSSSGFLLVLHSQSDREPLCPQGMPKLWTGYSLLYLEGQEK
AHNQDLGLAGSCLPVFNTMPFAYCNINQVCY
Download sequence
Identical sequences ENSGALP00000007904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]