SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000007941 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000007941
Domain Number 1 Region: 845-912
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.76e-19
Family TB module/8-cys domain 0.00076
Further Details:      
 
Domain Number 2 Region: 1949-2017
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.83e-19
Family TB module/8-cys domain 0.000018
Further Details:      
 
Domain Number 3 Region: 2228-2300
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-18
Family TB module/8-cys domain 0.00048
Further Details:      
 
Domain Number 4 Region: 1744-1870
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 2342-2471
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-17
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 6 Region: 2027-2155
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.96e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 346-471
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 8 Region: 432-552
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.65e-17
Family Growth factor receptor domain 0.0083
Further Details:      
 
Domain Number 9 Region: 550-623
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.96e-16
Family TB module/8-cys domain 0.00066
Further Details:      
 
Domain Number 10 Region: 1422-1495
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-16
Family TB module/8-cys domain 0.0000181
Further Details:      
 
Domain Number 11 Region: 81-166
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 12 Region: 1581-1647
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000112
Family TB module/8-cys domain 0.00092
Further Details:      
 
Domain Number 13 Region: 1212-1347
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000259
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 14 Region: 1096-1230
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000275
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 15 Region: 228-293
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000916
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 16 Region: 742-826
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000144
Family TB module/8-cys domain 0.0022
Further Details:      
 
Domain Number 17 Region: 2468-2584
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000118
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 18 Region: 123-238
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 19 Region: 922-1050
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000502
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 20 Region: 663-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000057
Family EGF-type module 0.005
Further Details:      
 
Domain Number 21 Region: 1903-1952
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000444
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 22 Region: 621-675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000599
Family EGF-type module 0.006
Further Details:      
 
Domain Number 23 Region: 1050-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000046
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 24 Region: 1378-1425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000774
Family EGF-type module 0.00027
Further Details:      
 
Domain Number 25 Region: 1501-1550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.00051
Further Details:      
 
Domain Number 26 Region: 1662-1711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 27 Region: 1336-1384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000143
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 28 Region: 1863-1906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000028
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 29 Region: 2299-2348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000345
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 30 Region: 2181-2230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 31 Region: 1705-1742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000271
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 32 Region: 1545-1587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000055
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 33 Region: 705-743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000241
Family EGF-type module 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000007941
Domain Number - Region: 2144-2186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000326
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 52-85
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00291
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 18-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0778
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000007941   Gene: ENSGALG00000004960   Transcript: ENSGALT00000007955
Sequence length 2768
Comment pep:known_by_projection chromosome:Galgal4:10:9669985:9805190:-1 gene:ENSGALG00000004960 transcript:ENSGALT00000007955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTCPNGQIAPSCGSKSIQHCNIRCMNGGSCSDDHCLCQKGYTGTHCGQPVCENGCLNGG
RCVAPNRCACTYGFTGPQCERDYRTGPCFTLVTNQMCQGQLSGIVCTKTLCCATVGRAWG
HPCEMCPAQPHPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFECKCPAGHK
FNEVTQKCDDIDECSTIPGICDGGECSNTVSSYFCKCPPGFYTAPDGLKCIDVRPGYCFS
TLTNGRCGNQLPQPLSKMQCCCDSGRCWSSTAASAPEMCPIRSTDEYRKLCSVAALLPAR
PDLPPGRPEVIPPPLLPGPYPPLVPQQPEIVYPSRAPPPHVILPVNFTDYCQLFRHLCLN
GHCIPTPGSYRCKCNKGFQLDVRGECIDVDECEKNPCISGDCVNTQGSYMCQCRIGYQST
PTRTECRDIDECLQNGRICNNGRCINTDGSFHCVCNAGFQVAADGKNCEDMDECNIRNMC
LNGMCINEDGSFKCICKPGFQLASDGRYCRDIDECETAGICMNGRCVNTDGSFRCECFPG
LAVGLDGRVCVDTHMRSTCYGGYKRGQCVRPLTGAVTKSECCCASTDYAFGEPCQPCPAQ
NSAEYQALCSSGSGMTAGGNDINECLLDPDLCPNGRCENLHGTYKCICNPGYEVDSTGKN
CIDIDECVLNTLLCDNGQCRNTPGSFTCTCPKGFVYTPDLKTCEDIDECESNPCVNGVCK
NTPGSFACECSPESTLDTTRTVCIETVKGTCWQNMVDGRCEININGATLKSECCSTLGAA
WGSPCTQCERDRICQKGFSRVRGTVCEDVNECEVFPGVCTNGQCVNTLGSFVCQCPSGMT
LDASGRTCLDIRLESCYLQHEDEQCTAQIPGRHRMDACCCSVGAAWGFECEECPLKGSPE
FEALCPRGAGFSTKIEITGKPFSKDINECKMVPSLCTHGKCRNTIGSFKCRCDSGFALDS
EERNCTDIDECRISPDLCGQGICVNTPGDFECECFEGYESGFMMMKNCMDIDECQRNPLL
CRGGTCINTEGSFRCDCPPGHHISPNISACIDINECDLSTNLCRNGHCVNLIGKYQCACN
PGYQSTADKLHCIDIDECSIMNGGCENFCTNSEGSYECSCKQGFALMPDHRTCTDIDECE
DNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLHPNICLSGTCENTKGSF
ICHCDMGYSGKKGTTGCTDINECEIGAHNCDRHAVCTNIPGSFKCSCSSGWIGNGIKCTD
LDECSNGTHKCSPHADCKNTMGSYRCLCKEGYTGDGFTCTDLDECSENLNLCENGQCLNA
PGGYRCECDMGFLPSLDGKACEDIDECSLPNICVYGTCHNLPGLFRCECEVGYELDRSGG
NCTDVNECADPTTCISGTCVNTAGSYTCECPPDFELNPTRVGCVDTRSGNCYLDIKTRGD
NGGTFCSNEIGVGVSKASCCCSLGRAWGVPCEQCPSVNTTEYKILCPGGEGFRPNPITVI
LEDIDECQELPGLCQGGKCINTFGSFQCQCPSGYYLNEETRVCDDVNECDTPGICGPGTC
YNTVGNYTCICPPDYMQVNGGNNCMDMRRSLCYRNYYADNQTCDGELLFNMTKKMCCCSY
NIGRAWNKPCEQCPIPSTDEFSTLCGSQRPGFFIDIYTGLPVDIDECREIPGVCENGICI
NMVGSFRCECPVGFFYNDKLLICEDIDECQNGPVCQQNAECVNTAGSYRCDCKPGYRFTS
TGRCTDRNECQEIPNICSHGQCIDTVGSFYCICHNGFKTNDDRTMCIDINECERDACANG
TCRNTIGSFNCRCNLGFILSHNNDCIDVDECASGNGMLCRNGQCVNTIGSFQCLCNDGYE
VSLDGRTCADVNECAREPGKCAPGTCQNLDGSFRCICPPGYVLQNEKCEDIDECVEQPEI
CALGTCSNTPGSFKCLCPEGFVLSSTGRRCQDLRVSYCFTKFEDGKCSVPKSRNHSKQEC
CCALKGQGWGDPCELCPEEADEAFRQICPFGIGILVGPGDARLDVDECLDPDNCKFGQCI
NTDGSFRCECPYGYILQETQCVDTDECAVGNPCGNGTCRNVVGGFECTCVDGFEPGPMMT
CEDVNECIQNPLLCAFRCVNTFGSYECKCPAGYVLREDRRMCRDQNECEEGIHDCDSKQM
ECKNLIGTYMCICGPGYQRRPDGEGCIDENECQTKPGLCENGRCVNTVGSYRCECNEGFT
VSDTQNECLDNREGYCFTEVLQSMCQIGSSNRNSVTKSECCCDGGRGWGPNCEVCPFPGT
VAFKKLCPHGRGYMSNGADIDECKVIHDVCRNGECINERGSYRCHCNLGYTTDITGTLCI
DLNECNESPKPCNFICKNTEGSFQCSCPKGYILQEDGRSCKDLDECATKQHNCQFLCVNT
IGGFTCKCPPGFTQHHTACIDNNECATEINLCGAKGICQNTPGSFVCECQRGFSLDQTGL
SCEDVDECDGNHRCQHGCQNIIGGYRCSCPQGYLQHYQWNQCVDENECLSAHICGGASCH
NTLGSYKCMCPTGFQYEQFSGGCQDINECGSAQAPCSYGCSNTEGGYVCGCPPGYFRIGQ
GHCVSGVGLGKGQGQELSLSGEMDDNSLSPEACYECKINGYPKRGRKRRSTNETANEAED
EQELEPPVSLASWDIEKAAVFSINISDLSNKFRILKLLPALTTLTNHNRYLIDSGNEDGF
FRINKKDGISYLHFTKKKPVPGNYSLQISSIPLYKKKELNQLEEKHDKDYLSGELGDNLK
MKIQILLH
Download sequence
Identical sequences ENSGALP00000007941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]