SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008329 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008329
Domain Number 1 Region: 185-334
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-22
Family C-type lectin domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000008329
Domain Number - Region: 97-184
Classification Level Classification E-value
Superfamily Tropomyosin 0.00425
Family Tropomyosin 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008329   Gene: ENSGALG00000005194   Transcript: ENSGALT00000008343
Sequence length 341
Comment pep:known chromosome:Galgal4:Z:8915576:8919172:-1 gene:ENSGALG00000005194 transcript:ENSGALT00000008343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGVLYTDLRFAKGPGGRGTASQALEAALGMDEAESPHENITPELMPVGTAEERARHSP
GCWSHRRCVPVGLLALSLLLLVAAVVLGSFYWQVTRQLQDTSREQVAERGRFSQEVRVRD
QSLEQMQKELAQVREELQQAWQEGNNSQQELGRWEAELAHVSRTLAATQKELSSVQGRLN
ASESTVTLLRSCTAIDCCPSGWLLYRGKCLFISTDKKTWDDSRAECEEKYSQLLITKSWS
RWTVPSFLKNADIAYWIGLQKNKYPWYEYDWLEEGEPDGEGLTDAWFWVDGSLYERPWQP
KSNGSCAVISRGNIKPAPCEAPEDLHLWICEKAAGPSSPFI
Download sequence
Identical sequences Q90WF6
ENSGALP00000008329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]