SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008508 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008508
Domain Number 1 Region: 552-812
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.47e-88
Family Eukaryotic proteases 0.0005
Further Details:      
 
Domain Number 2 Region: 19-278
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.75e-82
Family Eukaryotic proteases 0.00077
Further Details:      
 
Domain Number 3 Region: 422-530
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-29
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 4 Region: 297-404
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-27
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008508   Gene: ENSGALG00000005318   Transcript: ENSGALT00000008522
Sequence length 821
Comment pep:known_by_projection chromosome:Galgal4:5:6858172:6880050:-1 gene:ENSGALG00000005318 transcript:ENSGALT00000008522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQAKDPKCGQKVHETKPWSYFNLFTRIVGGNQVKQGSHPWQVSLKRREKHFCGGTIVS
AQWVVTAAHCVSDRNLLKYLNVTAGEHDLRIRENGEQTLPVKYIIKHPNFDPRRPMNYDI
ALLKLDGTFNFSSSVLPACLPDPGEKFEAGYICTACGWGRLRENGVLPQVLYEVNLPILN
SMECSRALSTLRKPIQGDTILCAGFPDGGKDACQGDSGGPLLCRRKHGAWILAGVISWGM
GCARGWRGNEMKRHYERGSPGIFTDLSAVLSWIQENLSDFKKEFPLRQVSFCSVQDGKLT
DSEGELNFPGGSEQFYQNHQLCIWTLFVPEGNYILLHFSHFDIEPETFCDYDSLSVYSKD
NRLVGKFCGGDLPLPILIGSNNIRLKFVSDNKDYGTGFSMTYKALTTGILPGFLDSGCES
LAVLFEEGVLQSMHYPENYSNLAVCQWIICAPEDHVIKLTYQTFEVEESEDCSYDAVTVY
EDAGKEEEIAKSCGFVLPAPVLSSSSMMLVVFHSDETETFEGFRATITFVHVTGSRILVE
VFENTDMTEEEIQVTTDDVCGMPSNQPRFIFSRIIGGEEAVPHSWPWQVSIQISDQHICG
GAVLAKEWVITAAHCFNSKELYRDLWMVVTGIHDLTEQEYRQKRSVKQYIIHPSFNKTTM
DSDIALLQLAEPLEFNHYVHPVCLPAKEEVVQPSSVCIITGWGAQEEDREKSKKLYQLEV
PILMLEACQTYYINLPSRVTQRMICAGFPLEEGKDSCTGDSGGPLVCPSEDGSGFYTLHG
ITSWGLGCGRKSYPGVYTNVGVFVDWIKQSINSSDLPIFLV
Download sequence
Identical sequences ENSGALP00000008508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]