SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008559 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008559
Domain Number 1 Region: 298-501
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.61e-53
Family Reprolysin-like 0.0003
Further Details:      
 
Domain Number 2 Region: 591-648
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000131
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 938-995
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000471
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 1132-1184
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000051
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 999-1055
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000667
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 6 Region: 882-935
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000017
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 7 Region: 1061-1122
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000445
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008559   Gene: ENSGALG00000005347   Transcript: ENSGALT00000008573
Sequence length 1228
Comment pep:known_by_projection chromosome:Galgal4:11:13255162:13323250:-1 gene:ENSGALG00000005347 transcript:ENSGALT00000008573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCLLLVVWTLPAAILSGSSMQFPTFLWLGNAVKTLQLCCLCCMSHAASLTSDSISSSEL
NHDYVFVTPVKVDSSGLYISHNVLHSTRKKRSTHSSRSSLHYKFSAFGQELHLELKPSTI
LSNSFIVQVLGKDGVSNSQEHEIEQCFYQGFIRNDSTSSVAISTCVGLSGLIRTRKIEFL
ISPLPQQLAQEHNYTSPAGHHPHVLYKRTAEEKVHRYTVESNPKSFSLGHHRTHIYHKYH
AQANGYHHGRFQKQHFCGRRKKYAPKPPTEETYIRSDEYGTSARFRRSSAKIQKNGSLNV
ETLVVADKKMVEKHGKENVTTYILTVMNMVSSLFKDGTIGSDINIIVVSLLLLEQEPSGL
LINHHADQSLNSFCQWQSALVGKNGKRHDHAILLTGFDICSWKNEPCDTLGFAPISGMCS
KYRSCTINEDTGLGLAFTIAHESGHNFGMIHDGEGNPCRKAEGNIMSPTLTGNNGVFSWS
VCSRQYLNKFLSTAQAACLIDEPKQTGQYKYPDKLPGQMYDADTQCKWQFGMRAKVCNLS
FVKDICKSLWCHKVGHRCETKFMPAAEGTACGINMWCRRGQCVKYGDHGPKPVNGHWSAW
SEWSQCTRTCGGGVTYQERHCNNPKPQYGGKFCQGSSRIYELCNHQPCPASSLDFRAQQC
AEYNSKPFRGWYYKWKPYTKVEEEDRCKLYCTAEDFDFFFAMSSKVKDGTLCSPNKYDVC
IDGICEQVGCDHGLGSKAVLDACGVCKGDNSTCKFFKGQYLIQHKANDYYAVVTIPAGAR
SIHLHEMQISNSYLAVRNLSKKYYLTGDWTIDWPGKFPFAGTVFDYQRSFNHPESLYAAG
PTNETLVFEILLQGRNPGIAWEYTFSKMNENKTSVKKHSHSWVTVQSECSATCGGGHITA
KAICLEDHRTRVNSSFCGPRMKPLTETKLCNTNPCPAHWSAGEWSACSKSCGGGQQSRLI
QCVQKKAFQREEVVAHSLCPVSTPTQVQICNSQDCPPEWSPGLWSQCSKTCGRGVKKRDV
YCTSTSSPKLKILPESMCSQDHKPESQQTCVLGRCPKNDRLQWVIASWSECSASCGPAVR
KRELKCGEKSIHGKLITFPQRRCRNIKKPNIDLEEACNNGPCPSQTLYNMVSGWYSSPWQ
QCTVTCGGGVQTRSVQCLRQGRPASGCLPHQKPAILRACNTNFCPAPSKRDDPSCVDFFS
WCHLVPQHGVCNHKFYGKQCCKSCTKKN
Download sequence
Identical sequences ENSGALP00000008559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]