SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008841 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008841
Domain Number 1 Region: 249-442
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.1e-59
Family Astacin 0.0000905
Further Details:      
 
Domain Number 2 Region: 874-983
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-37
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 3 Region: 714-824
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-36
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 4 Region: 565-667
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 449-558
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-35
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 6 Region: 1005-1098
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-29
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 7 Region: 669-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000016
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 825-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000197
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008841   Gene: ENSGALG00000005519   Transcript: ENSGALT00000008855
Sequence length 1109
Comment pep:known_by_projection chromosome:Galgal4:6:16142744:16223667:-1 gene:ENSGALG00000005519 transcript:ENSGALT00000008855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQSVPLSVLAVRRPRDEAFLFGYPSWTEGSSGACLGEATPRQRSSGCSHPAAVPAVARA
LPALPTRGEAAEVRAGDSGASSGFTHQPDLPARLPVSKLPSPPWQGSACCLRVSLGVFSF
LRWIVSGCFRAHLNRSDFLKSFHHHSDLTAFWGDIALDEDDLKLFQIDRTVDLTKHSAGN
ARHTSGGLGEQSFEPSENTTSTDSKKAVKTDGRQNTTLVRSLKKKEYKDESGMDARSSPR
VRRATTSRAERIWPGGVIPYVIGGNFTGTQRAIFKQAMRHWEKHTCVTFVERTDEESFIV
FTYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTII
RENIQQGQEYNFLKMEAGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRDDNGVRP
TIGQRVRLSQGDIAQARKLYKCPACGETLQDSTGNFSAPGFPSGYPSYSHCVWRISVTPG
EKIMLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGRFCGDKIPEPVISTDSRLWIEFR
SSSNILGKGFFVVYEAICGGEVRKDAGQIQSPNYPDDYRPSKECIWKITVSEGFHIGISF
QAFEIEWHDACSYDYLEIRDGLTENSPLIGQFCGYEKPEDIKSSSNKIWMKFTSDATISK
AGFAANFFKEMDECSQPDNGGCEQHCENTLGSYKCTCEPGYELTADKKSCEAACGGFITK
LNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFDLEGNDVCKYDYVEVRSGLAT
DSKLHGKFCGSEKPEVITSYSNNIRLEFKSDNTVSKKGFKVHFFSDKDECSKDNGGCQHE
CINTFGSYVCQCRNGFKLHENNHDCKEAGCEHKLSSAEGMMSSPNWPDKYPSRKECTWNI
SATPGHRVKVTFHEFEIEQHQECAYDHLEMYDGPNSKSPILGRFCGSKKPDPVVASTNKM
FLRFYSDASVQRKGFQAKHSTVCGGLLKAEVQTKELYSHAQFGDNNYPGQANCDWVIVAE
DGYGVELMFQTFEIEEEADCGYDYMEIYDGYDSTAPRLGRFCGSGPLEEIYSAGDSIMIR
FHTDDTINKKGFHAQYISTKFQDALHMRK
Download sequence
Identical sequences F1NRI8
ENSGALP00000008841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]