SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000008938 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000008938
Domain Number 1 Region: 554-660
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-23
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 365-486
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000103
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 3 Region: 667-732
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000135
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 726-788
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000389
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 794-853
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000983
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 197-312
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000196
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Domain Number 7 Region: 311-372
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000012
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 8 Region: 485-544
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000256
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000008938   Gene: ENSGALG00000005577   Transcript: ENSGALT00000008952
Sequence length 946
Comment pep:known_by_projection chromosome:Galgal4:15:7123775:7135058:1 gene:ENSGALG00000005577 transcript:ENSGALT00000008952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGPRQGTALNLLPAAEDSPKPAVEGPSLRAQSHISPAPTTDPGADTRQTFPAKKKPPAL
KHSNTARKQLKAKPTLPGLSRAVSTQGSVLPVSSQEPSMPTETADGQRQSPPELPGWGPT
SRPLLQISPFTPVPSTAQPFPGGPGDVGTGPTAAPSGAINQMDSAESEMNGSASEESQET
TTSTIITTTVITTEPTPVRCSVSFYDPEGYIDSTDYPPLPRHSFLECTYNVTVYTGYGVE
LQVKSVNLSDGEVLSIRGVDDDTLVVLANQTLLVEGQVIRSPTNTISVYFRTFQDEAVGT
FQLHYQVFMLSCSFPRRPDFGDVTVMDLHSGGIAHFHCHLGYELQGPHMLTCINASRPHW
SSPEPICSAPCGGTVHNATIGRVLSPSTAGNQSGSMYCVWAITAPPGQKLHLHFEKLLLA
ERDRMVVYSGDSNRSAVLYDSLRADSVPFKGVISDDSSIRIDFLAEEPAASTAFNIRFEA
FERGHCYEPYIQNGNFTTSDPTYNLGTTVEFTCDPGHSLEQGPAVIECVNMRDPYWNDTE
PLCRGQCPHVRGELTAMAGVILSPNWPEPYTEGEDCIWRVHVGEEKRLFLDIQLLNLTNS
DILTIYDGDELSARILGQYVGSSGPQKLYSSSPDLTIRFHSDPAGLIFGKGQGFIMNYIE
VSRNDSCSDLPEIQNGWKTTSHTELVRGAKITYQCDPGYDIVGSDTLTCQWDLSWSSDPP
FCEKIMYCTDPGEVEHSTRLISDPVLLVGTTIQYTCNPGFVLEGSSLLTCYSRETGTPIW
TSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGESLTFMCYEGFELMGEVTIKCILG
QPSHWSGPLPICKVNQDSFEHALEVAEAAAETSLEGGNMALAIFIPVLIISLLLGGAYIY
ITRCRYYSSLRLPLMYSHPYSQITVETEFDNPIYETGETREYEVSI
Download sequence
Identical sequences ENSGALP00000008938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]