SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009154 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009154
Domain Number 1 Region: 3061-3164
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 5.35e-28
Family Colipase-binding domain 0.04
Further Details:      
 
Domain Number 2 Region: 347-481
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-27
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 21-128
Classification Level Classification E-value
Superfamily L domain-like 2.79e-21
Family Ngr ectodomain-like 0.0035
Further Details:      
 
Domain Number 4 Region: 1979-2099
Classification Level Classification E-value
Superfamily PKD domain 3.77e-19
Family PKD domain 0.0056
Further Details:      
 
Domain Number 5 Region: 1042-1164
Classification Level Classification E-value
Superfamily PKD domain 7.06e-19
Family PKD domain 0.0026
Further Details:      
 
Domain Number 6 Region: 1638-1757
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000131
Family PKD domain 0.0083
Further Details:      
 
Domain Number 7 Region: 1429-1497
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000353
Family PKD domain 0.0022
Further Details:      
 
Domain Number 8 Region: 1263-1332
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000392
Family PKD domain 0.0042
Further Details:      
 
Domain Number 9 Region: 1765-1841
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000889
Family PKD domain 0.0068
Further Details:      
 
Domain Number 10 Region: 1846-1925
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000327
Family PKD domain 0.008
Further Details:      
 
Domain Number 11 Region: 1341-1414
Classification Level Classification E-value
Superfamily PKD domain 0.000000000144
Family PKD domain 0.0031
Further Details:      
 
Domain Number 12 Region: 1503-1583
Classification Level Classification E-value
Superfamily PKD domain 0.000000000314
Family PKD domain 0.012
Further Details:      
 
Domain Number 13 Region: 964-1076
Classification Level Classification E-value
Superfamily PKD domain 0.000000000353
Family PKD domain 0.0082
Further Details:      
 
Domain Number 14 Region: 1175-1246
Classification Level Classification E-value
Superfamily PKD domain 0.0000000011
Family PKD domain 0.0058
Further Details:      
 
Domain Number 15 Region: 232-299
Classification Level Classification E-value
Superfamily PKD domain 0.00000000119
Family PKD domain 0.001
Further Details:      
 
Domain Number 16 Region: 856-967
Classification Level Classification E-value
Superfamily PKD domain 0.00000102
Family PKD domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000009154
Domain Number - Region: 2322-2355
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.044
Family Di-heme elbow motif 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009154   Gene: ENSGALG00000005714   Transcript: ENSGALT00000009168
Sequence length 4277
Comment pep:known_by_projection chromosome:Galgal4:14:6293316:6343474:-1 gene:ENSGALG00000005714 transcript:ENSGALT00000009168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGLEFIGNKQRLISEISILRDLSRNKISALDVQMFRSLTSLAKLDISHNKISTLEEGIFD
NLFNLSEINLSWNPFFCDCKLSWLPRWVEDRKVTVLQAADTRCAHPPGVANLSLFSVSFV
NATCGAQYVTCLTSNHTDEAELVILFTSSHPGNLTEETCSALCYADDQEYGGFSPQGQCL
CGTAHEPNSSSSCLLFCTEHSSGQACGGPSLIHFPFQAQLSVSFIGLKPRYSLHEAVLFN
VSIPIAVSTLIWEFGDQTEVLNTTGNAAVHTYALPGQYNVTATLFVGTKVSYVQAEIEVV
ASPQQLELQCPSLIKTNESLDIRIRNRGGTGLTVLYGITAESGEPGRAVHPMCPHDGLVF
PGNNHCYQLVVEKAEWLEAQQHCQEHGNGELAFVSSPEIQSFLVTHVIRRSLDVWIGFND
FASSEAQQRGEGFNIESCQNWLPGEPHPSNADHCVRMGPTGQCNTDLCMAKHSYVCEFKP
KGVLLNAENFFVGDPVFDTHVAAKNVIEDTLSSPLQAVEVMVFPELAFRHEGYLSALEFV
TQELHQPIQMRFQVHRPIDGKEYQEGQNATEPFPTSQDDGNYTLVECPPGFQWCHLTNLC
SSVNNCCNAMECTNSSFASSPIPASPQHKGSQLSYELVKEFLFTIPAGPSAPYLVTFSKE
DVFVRAKDVLSIQHNAGMGSFLQCQPSTTSPFRTNYFSTNSSDWALGLPASSIGATWIHN
TVCSLRVLYAKEQLVPIISPQNAGLAHPGLYTVRASVDNGIFSANLSCNFWVTSQVSGLR
VVHPAPQGGKVYVPSDHITLVVKISSGMNATARWLGDNHTFPFEEACPLTIAPLTSDCAR
ENNDTWFAVLSLSGLKEGASTHTLVAENAISSQNITITIKVEQPIRGLRATPDPESRVLL
NTRVSYVPVMEAGSDVTFRWTVDDKPSFTFYNVVFNVIYQSPAVYKLSLTASNHVSNFTV
NYNVTVEMMNKMKNLTVLGIPPVLPQNSTVEFTARVQVDSAVDAMFLWDFGDGIQETYQF
TPPYNKSFLVPDPSVHEVIIEHNVSHVYEYPGDYILVVQVSNQFENLTCLTPVRVHSYLV
DVQIETVKDVLVVNRSVTFRAIPLPSPYGVLYTWDFGDGSSLVTESQSTVTYSYSSRGVY
NISVSANNTINSVETVECYQVFEEITGLHVAADEVAEVGATVTLNASVQTGDSITWIFDM
GDGTVLRSQVPVVEHVYTKDINCTVNVTAVNPVNSVSQTIPVWIFVLEVLRIDPTSCILE
HPDVQLTAYVTGNPDEYIFDWTFGDGSSNVTVSGDPVVMHNFTRSGTFPLSLTLSSRFNK
AHYFTSVCVEPEIVNVTLLPSKQFVRLGEECSFQVSAVPLYQYRYRWDFGNNESTRSSGT
EVSYNYKSTGVFLVTVTVSNNVSFNNDTAFVEVQEPVGVAKIEYNGTKVLELNQIYLFSA
SMNGTKVNYFWDFGDGITQPGQITTHSYNNTGHYTISVTGQNDVSTNETRVDVTVKRRLH
GITINASRTIVPLNGSVSFVATLVAGSAIRYSWILCDRCTPIQGSSTISYTFRSVGTFNV
IVTAENEISSLQDSIYVYVLEQIEGLQVASSDLVEDLYFPTNKTLHLHAVVREGTNISYS
WIAQKDGNAVQTATGKTFSLNVLEAGNYTVYLKATNMLGSTTANKTLEFIESLGLLKPYA
FPNPVAVNASVNISATITSGTGIVYVWYLEDGLSPVTSESFIIHSFQSPGAMEVVIGAEN
KLDSTNATISVYVEEVIEELSIGTAELDCRYVSSGSTVVFEGELQKGTEVTWLWEVPNGT
LTGQSVAVMFPTAGFYTVYLNASNDISWAVASRNISVLDRIQGLEVIASKKVVEPGEQVT
FVIRMSSGTSVSYLVSISGDYSVVLNGSKYTHEFTKSGDYLVTVTVQNQISIAHAQVLIS
VLEAVRDIRLLNCCERGIPTGTEKSFSAQVGSGSRVLFSWQFSLWKERGRSVVTAAGESV
SYTPEAAGLLEIHLRAFNDLGGINITRTIQVQDPILQVSLTASNAFVNRTALFEAAVIPN
GRGVEFLWTFGDGSSTQMTRVAVANYSYLSPGDYLVEVNATNLISFFVAHLTVTVKVLEC
EEPEVELALPPQVVMKRSQRNYLEAQLDLRGCIKYQTEHLWEIYRAPSCLHLDDSSRIHL
PNVDVNRPQLVIPKLALEVGNYCFVFIVSFGDTPLSKSIFANVTMIPSKLVPIIDGGSYR
VWSNTQDLILDGEKSYDPNLDDGEQTPLFYQWSCTFSSKSSAAGCSLNFSANGGNVTIPK
AVLEADVEYTFNLTVWKKGMNPEATNQTVFIKRGGVPIVSLECVSCKAQSVYEVSKSSYV
YLEGTCQNCHNDSKIGRWAAHSFKNKSLILDKKTTSTGDTGMNLVLRQGALKDGEGYTFT
LHITDLTTGEEGFASIDLLPNQPPIDGSCQLSPKGPLRALMAKVHFECTGWRDTESAEDP
LVYILLASRHRAGHYHEFCVYKGSRAEHSAFLPPGFHESGFVVSVSVLVQDQLGATVVAI
NQSMEIGLPEGFPSLSYWLYNQTDTVLQGLVKQGDPQQVIEYSLALITILNEYERSMLLE
PETGNEFELRTWTRNNITETLNSLNVNTVDDIQQISAALAQCTVVSKELVCKSCLTRTLN
KLESMMTILQGEMTQGTVTPTGIADNILNITGDLIHLVNTVSQESKPQELLADSHNLLLA
PKAYNLSSSLMRILMKSRVLNEEPLELVGGEIKATGKRSDPFNLLCYENTPNCQFSIPQA
FNTTLSNLTDVIQVMFQVDSNPFPFGYINNYTVSTKVASMEFQTYNGVQIPIGSLDSERA
ITVMVSNNTDADNLSAGTEVIEARTSVNLIVTMENNNREAGLHFRLTYKVLNDRYVASEP
EPFIMAYLHHEPEPNEHNCTASKKISLEALSGSDHKLYTFFTSPLTDDTIQKYYLNITNH
FSWSPVEVTLGLYTSLCQYFSEQEKRWKTEGIIPLEETRPDQAVCLTQHLTAFGASLFVP
PNSVQFIFPAPGSGLNYIVLLTCAVCFVTYSVAALIVHKLDMIDINRVGVIPFCGKNGLY
KYEILVKTGWGRGSGTTAHVGIALYGVDNKSGHRHLDGENAFHRNSLDVFQIATERNLGS
IWRIRIWHDNKGLSPSWYLQHVIVRDLQSSKSYFFLVNDWLSVESEENDGMVEKEVYAAS
ETELRSFSRIFIAELQRGFFEKHVWLSMWDRPPRSRFTRVQRATCCSLLIFLFLCANAVW
YGVVGNVHLSSGAVSNLIPVNVDTVAVGLVSSVVVYPLYLVILFLFRMARAKVSINHTVT
HSDQQSLEIDNYLDSSVLDSSFPTFPGLRAEQAFSEQTKTDLFLEDSKSLIRWPSSEALL
SWPDLLSDPSIMGNTIQKLKRGRASRHLGLEAPLATEEDNLSLGVHQGQPRYFSASDEDL
IRQILADGASGISHSQDLGPYMRAETDLISGLSSVFGEKVETVMMQKLNDKGQSMAAPPR
EVSRSAKSTWTVADQTFRKRLLPSWCSYLAHGISFFLFATSTGVSVWIGVGFSSSVALMW
LISGIFSFLASFLVWEPLKVLLEALYFSLVAKRLHPEEDDTLVEHPFVEHVSEKISKVRP
PQGFALFQAKEEARKVKLLHRMLKNFLIYMMFLLVILLTNYGDATRNSRAFLLQSSIKQQ
LGSSEFLHIKRSDQFWVWMSQVFLPYLYNNQSGQESYSTTLGVARLRQLRLQEVLLPPEI
EKNCIDSHSFSTADYAAGWERAAVNVTTAWSYSPPDLTGVWYWGYISFYDSGGYIQELGT
SLEEGRAQLNYLQQHTWIDNMSRVVFVELMQYNPSVDLHAAITLQLEFLGAGQAVTTVTI
SPFPLLRLSSGVTLQLLMMVFLMMFVVYFVVSESLSIKKEGRAYFTLWGNYGQWVFILLT
TCTVVVHLSQATLADQQWLKYLNNRKVFTNFYQVAFLNTVFSTLAASLLFLLIVQAAQQL
RFVRQWSVFGKTFQKSMKELTAAGLAFVVLILAYAQLGFLLFSSSSESFRSVGSSLLLLI
AMVRGGVSLYPCPPDSSGLYYLFCTSYIILEVWIVLRLFTVVLVYSYREMHFEMYRPAFE
PQDYEMVELFVRRLKMWMGFSKAKEFRHKVRFEGMEPLPSRDSSDSKSIRGPTPSAASDS
SRASTSSSQLDGLSLVLSTRDSLEVDADLQRLLSLFEMLLAQFDRVNQVTEDVYRIEHQL
QGSQSRRSRRRYCAGNTERGPSPETRSSVPSHLIRASRGISGAASVLPPHKAHSTLAPAV
KKKRPLRAKNRVHPTVK
Download sequence
Identical sequences 9031.ENSGALP00000009154 ENSGALP00000009152 ENSGALP00000009154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]